(data stored in ACNUC30630 zone)

EMBL: CP001738.PE602

CP001738.PE602       Location/Qualifiers
FT   CDS             687795..689195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0616"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96211"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4H6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96211.1"
FT                   /translation="MTQVRPTYPGSGMNSPIRNEAWQESTEGLGIRDLGIFKVWEDNFE
FT                   KLKTLVNSMKPDQLESGSKHYQNLAKDMNGTVTLLHRVAQDMVKQWGGKDAQAALEQMN
FT                   KAYRQAREIQQTSQQVGQAISNHAAKQKAWKQAYGPGSQTDSWVHEVKRWAGTIFAANP
FT                   ATLPAAPATIVGGFLKNNWDARQGMLEINEGTAASNRQFPEGIRVDMPTVNPNAFQNPP
FT                   GGPGNPGGPGGAPKMPGMPNGPGGPGLPDGPGYPGPGGPGGPNTPDLPGPGGPGGPNYP
FT                   GGDGPGGINPPGGGPGGPNYPGGPNSPGGPSYPGGPNYPGGPNYPGGPNYPGGGGLGSD
FT                   LAGFDPHPRPYGTGPGGNFGPPGGGGAGLPGGGLPGGGGGLPGGMPGGAGGVGGMPGAV
FT                   GGMPGGLGSTGKARAGIGGMGGMGMGMPMGAGAGHGGRQEERERTTWIPEDEDVWTGGE
FT                   EAGPSVIG"
     MTQVRPTYPG SGMNSPIRNE AWQESTEGLG IRDLGIFKVW EDNFEKLKTL VNSMKPDQLE        60
     SGSKHYQNLA KDMNGTVTLL HRVAQDMVKQ WGGKDAQAAL EQMNKAYRQA REIQQTSQQV       120
     GQAISNHAAK QKAWKQAYGP GSQTDSWVHE VKRWAGTIFA ANPATLPAAP ATIVGGFLKN       180
     NWDARQGMLE INEGTAASNR QFPEGIRVDM PTVNPNAFQN PPGGPGNPGG PGGAPKMPGM       240
     PNGPGGPGLP DGPGYPGPGG PGGPNTPDLP GPGGPGGPNY PGGDGPGGIN PPGGGPGGPN       300
     YPGGPNSPGG PSYPGGPNYP GGPNYPGGPN YPGGGGLGSD LAGFDPHPRP YGTGPGGNFG       360
     PPGGGGAGLP GGGLPGGGGG LPGGMPGGAG GVGGMPGAVG GMPGGLGSTG KARAGIGGMG       420
     GMGMGMPMGA GAGHGGRQEE RERTTWIPED EDVWTGGEEA GPSVIG                      466
//

If you have problems or comments...

PBIL Back to PBIL home page