(data stored in ACNUC30630 zone)

EMBL: CP001738.PE73

CP001738.PE73        Location/Qualifiers
FT   CDS             78528..79172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95682"
FT                   /db_xref="GOA:D1ADH2"
FT                   /db_xref="InterPro:IPR027273"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95682.1"
FT                   /translation="MKTFATSITVGVLGLSVWTAPLANADGSSVTGPQGQTLTVSKAAG
FT                   LSPDGEKITVTGRGYDPNKGIYVAFCKDNGPDKAPSPCGGGADTSGSTGGSVWVSSNPP
FT                   PYGKSLVVPYGPGGSFEVTINVSPKISDEVDCTKTKCVVATRADHTRSGDRTQDVRIPI
FT                   AFDEGGLPVPLIAGGAAAVAVIAVAGGALLIRRRSRAAAAAPADGGAGGDR"
     MKTFATSITV GVLGLSVWTA PLANADGSSV TGPQGQTLTV SKAAGLSPDG EKITVTGRGY        60
     DPNKGIYVAF CKDNGPDKAP SPCGGGADTS GSTGGSVWVS SNPPPYGKSL VVPYGPGGSF       120
     EVTINVSPKI SDEVDCTKTK CVVATRADHT RSGDRTQDVR IPIAFDEGGL PVPLIAGGAA       180
     AVAVIAVAGG ALLIRRRSRA AAAAPADGGA GGDR                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page