(data stored in ACNUC30630 zone)

EMBL: CP001738.PE74

CP001738.PE74        Location/Qualifiers
FT   CDS             79223..80230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0075"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   spe:Spro_2167 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95683"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH3"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACY95683.1"
FT                   /translation="MALALLAGLGLSGCAAGTAPAAGGGQDPAAGCGPSSMKVSYEPDP
FT                   IEPAPTPKLPVTVKSADGRKVTVRSADRILAVNMYGSIAEIVFSLGLGDRLVGRDASTT
FT                   FAAARDLPLVTVNGHDLSAEAILRLNPTVVLTDAGIGPAEVLDQLRASGIPVVLIGDEQ
FT                   TLPAVGEHITEVAAALGVPEAGQKLKKRVDEEIESARKQAPSGGEPLRVAFLYLRGTAG
FT                   VYLIGGRGAGSDALIEAIGAVDAGSAAGLTEFRPLTSEGMINAAPDVILVLTAGLKSVG
FT                   GVDGLVKLPGIAQTPAGRNRRIVDADDGTLLTFGTRTGKTIKALADAVYRPCES"
     MALALLAGLG LSGCAAGTAP AAGGGQDPAA GCGPSSMKVS YEPDPIEPAP TPKLPVTVKS        60
     ADGRKVTVRS ADRILAVNMY GSIAEIVFSL GLGDRLVGRD ASTTFAAARD LPLVTVNGHD       120
     LSAEAILRLN PTVVLTDAGI GPAEVLDQLR ASGIPVVLIG DEQTLPAVGE HITEVAAALG       180
     VPEAGQKLKK RVDEEIESAR KQAPSGGEPL RVAFLYLRGT AGVYLIGGRG AGSDALIEAI       240
     GAVDAGSAAG LTEFRPLTSE GMINAAPDVI LVLTAGLKSV GGVDGLVKLP GIAQTPAGRN       300
     RRIVDADDGT LLTFGTRTGK TIKALADAVY RPCES                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page