(data stored in ACNUC30630 zone)

EMBL: CP001738.PE79

CP001738.PE79        Location/Qualifiers
FT   CDS             83961..85175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0080"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   afw:Anae109_1425 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95688"
FT                   /db_xref="GOA:D1ADH8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACY95688.1"
FT                   /translation="MHVLRLCPVFEPPATALLGRGARFAPIGGMHSHTAQLTRALDELG
FT                   VRQTVVTTRPPTAPAVARLGRHCRVVRLGASGPLSRHCYGPAAWRRAPTLVRGVDLVHA
FT                   HLGEDPVVMPLALRTAACAGAPLVVTVHHSLQHTLRVSGPRSLLLKTVGGALERRLLEH
FT                   ADAVITLTERLHDLLPGDAVHVIPSGLGPEFTARSPARTWRMPDGDAVRPRLGYVGRLQ
FT                   AHKSVDVLLRAFALLGGDGGRLLIVGDGPQRPRLRRLAGRLGIAERVTFLGALSHDQIP
FT                   AVLRTLDAVVLPSRCEEFGSILPEAMHCGVPVVATQVGGIPELIEHGRSGLLVPPGSPA
FT                   RLADALRRLLGDPGLAAAMAGRARRRVRGHTWDRLARRVLKVYQSVLTTPAPQPLPASK
FT                   VVPIK"
     MHVLRLCPVF EPPATALLGR GARFAPIGGM HSHTAQLTRA LDELGVRQTV VTTRPPTAPA        60
     VARLGRHCRV VRLGASGPLS RHCYGPAAWR RAPTLVRGVD LVHAHLGEDP VVMPLALRTA       120
     ACAGAPLVVT VHHSLQHTLR VSGPRSLLLK TVGGALERRL LEHADAVITL TERLHDLLPG       180
     DAVHVIPSGL GPEFTARSPA RTWRMPDGDA VRPRLGYVGR LQAHKSVDVL LRAFALLGGD       240
     GGRLLIVGDG PQRPRLRRLA GRLGIAERVT FLGALSHDQI PAVLRTLDAV VLPSRCEEFG       300
     SILPEAMHCG VPVVATQVGG IPELIEHGRS GLLVPPGSPA RLADALRRLL GDPGLAAAMA       360
     GRARRRVRGH TWDRLARRVL KVYQSVLTTP APQPLPASKV VPIK                        404
//

If you have problems or comments...

PBIL Back to PBIL home page