(data stored in ACNUC30630 zone)

EMBL: CP001738.PE93

CP001738.PE93        Location/Qualifiers
FT   CDS             96461..98326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0094"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: gur:Gura_1221 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; PAS fold
FT                   domain protein; PAS fold-4 domain protein; GAF domain
FT                   protein; PAS fold-3 domain protein; histidine kinase A
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; GAF domain
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95702"
FT                   /db_xref="GOA:D1ADJ2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADJ2"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACY95702.1"
FT                   /translation="MTDVGQAPGGQDAIVRAVIECAADAIVAIDPRFRVTLWNPAAERL
FT                   FGWSAAEVLGQLPPIIPDELRAEQNAVLERVREGGQLSVATRRLRRDGQLIDVRIDTSP
FT                   LHDADGRLLGWMGVYHPVAETDAAQHQLAERARLVRRLNDVVADLNAERDLPAVLDRIT
FT                   TALVELTGADAGGFVQIKGRSLELVSVQGLPERLRGTVTELDSSLVDELLRSGKPVLLA
FT                   GARRVDEAIRAHLPGLHTVALGLSYLQNRPYGALYALFSGRKAGDTELELLELLAGHAG
FT                   VAVGNAVAYADAVRQQAHERAVIDSSADGIVVLDAAGIVRQWNPAAARLTGLPAEQVIG
FT                   RPPPLQIPEPGCTLTVRLESGTWVNMLCSQVEETGELVVDLRDVTEAKALEEAKDLFLA
FT                   TAGHELRTPITVVQGFASTLVSRWDKLGDAERRAAVETIAERARALARLVEHLLLGSRA
FT                   GTGELKVTIEHFDLGRLLEASVAGFRSLSDLHRVELEVAPDLPKVAGDWMATDIILGQL
FT                   LENAFKYSPDGGTVTVRAWAEGDELVVTVADRGVGIAPGDHERIFERFFQGDSGDRRRF
FT                   GGIGLGLYIVKRLAQAQRGDVAAHSRPGGGTVMRLTLPAAHASGD"
     MTDVGQAPGG QDAIVRAVIE CAADAIVAID PRFRVTLWNP AAERLFGWSA AEVLGQLPPI        60
     IPDELRAEQN AVLERVREGG QLSVATRRLR RDGQLIDVRI DTSPLHDADG RLLGWMGVYH       120
     PVAETDAAQH QLAERARLVR RLNDVVADLN AERDLPAVLD RITTALVELT GADAGGFVQI       180
     KGRSLELVSV QGLPERLRGT VTELDSSLVD ELLRSGKPVL LAGARRVDEA IRAHLPGLHT       240
     VALGLSYLQN RPYGALYALF SGRKAGDTEL ELLELLAGHA GVAVGNAVAY ADAVRQQAHE       300
     RAVIDSSADG IVVLDAAGIV RQWNPAAARL TGLPAEQVIG RPPPLQIPEP GCTLTVRLES       360
     GTWVNMLCSQ VEETGELVVD LRDVTEAKAL EEAKDLFLAT AGHELRTPIT VVQGFASTLV       420
     SRWDKLGDAE RRAAVETIAE RARALARLVE HLLLGSRAGT GELKVTIEHF DLGRLLEASV       480
     AGFRSLSDLH RVELEVAPDL PKVAGDWMAT DIILGQLLEN AFKYSPDGGT VTVRAWAEGD       540
     ELVVTVADRG VGIAPGDHER IFERFFQGDS GDRRRFGGIG LGLYIVKRLA QAQRGDVAAH       600
     SRPGGGTVMR LTLPAAHASG D                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page