(data stored in ACNUC30630 zone)

EMBL: CP001738.PE96

CP001738.PE96        Location/Qualifiers
FT   CDS             100772..102361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0097"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   GK10816 gene product from transcript GK10816- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95705"
FT                   /db_xref="GOA:D1ADJ5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADJ5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY95705.1"
FT                   /translation="MLRVVRRPSAHTVHLGAATLLRISAEGLGTALVLVVQARTGQAAT
FT                   AGFLQAAIMLPYVLAGPITGHTLDRTARPRAFALTMTACYLLAAAFLLLTAGRVPLLLA
FT                   LAFAVAIGCTEPVVVAFTGLLPRFVPAHRLTWAYGLEAATYNIAAIAGPGLAAGLTAAL
FT                   GAGYAGAAVVGCATLGMTLLPLLSVPPPGHRPAPARRPEETGERPAAELAPAVGPDTAG
FT                   TRSQDAGRRAAGEHSEQPAAAIGRGGATARPEPAEAREEGRPAGSAGPGGAACHAVTAE
FT                   AQGSGGPSAGNAGPGEAETPRDERVGAALSKEPAPEMKKDVPALKGRAPALDVIAGGIV
FT                   VLLGNPVLRAVTVATTLAFLGMGAVAVTAVLFAEHIGRSAGVGGQLIAAFAAGSLIGSL
FT                   GSARWLSARRAEWVLMAGMAAFGTALAVTVWAPSLPWALAGFLLAGICDGPVFAATLTV
FT                   RQREAPADRLGQVNTTGGSLKIGSAAVGAALAGALAGSLGGPGLLLGMAAFQFTGAACG
FT                   VLLLLLARRRGE"
     MLRVVRRPSA HTVHLGAATL LRISAEGLGT ALVLVVQART GQAATAGFLQ AAIMLPYVLA        60
     GPITGHTLDR TARPRAFALT MTACYLLAAA FLLLTAGRVP LLLALAFAVA IGCTEPVVVA       120
     FTGLLPRFVP AHRLTWAYGL EAATYNIAAI AGPGLAAGLT AALGAGYAGA AVVGCATLGM       180
     TLLPLLSVPP PGHRPAPARR PEETGERPAA ELAPAVGPDT AGTRSQDAGR RAAGEHSEQP       240
     AAAIGRGGAT ARPEPAEARE EGRPAGSAGP GGAACHAVTA EAQGSGGPSA GNAGPGEAET       300
     PRDERVGAAL SKEPAPEMKK DVPALKGRAP ALDVIAGGIV VLLGNPVLRA VTVATTLAFL       360
     GMGAVAVTAV LFAEHIGRSA GVGGQLIAAF AAGSLIGSLG SARWLSARRA EWVLMAGMAA       420
     FGTALAVTVW APSLPWALAG FLLAGICDGP VFAATLTVRQ REAPADRLGQ VNTTGGSLKI       480
     GSAAVGAALA GALAGSLGGP GLLLGMAAFQ FTGAACGVLL LLLARRRGE                   529
//

If you have problems or comments...

PBIL Back to PBIL home page