(data stored in ACNUC7421 zone)

EMBL: CP001743.PE100

CP001743.PE100       Location/Qualifiers
FT   CDS             79172..80362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0101"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; Arsenical pump membrane
FT                   protein; SPTR: A7CSU5 Citrate transporter; InterPro
FT                   IPR000802:IPR004680; COGs: COG1055 Na+/H+ antiporter NhaD
FT                   and related arsenite permease; KEGG: sus:Acid_4340 citrate
FT                   transporter; PFAM: Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26882"
FT                   /protein_id="ADD26882.1"
FT                   /translation="MELLAYLVLGLTYLGLGLGYWPGYRMNRAAIALTGAAFLIVLGVL
FT                   NFEEAWRALEPHTLGFLFGVMVLNAHLAYAGFFQLTLNGLVHLARSPLGLLVWLTFGTG
FT                   LLSALFLNDTIAILFTPLVLALTRTLGLPPVPYLLALAGATNLGSVATLTGNPQNIVVG
FT                   SLSRITYLDFAAALTPVALVGLAVQVGLLYALYPAVRSRAPLPPLPPLRFRFNRALLFK
FT                   GAWITLALLAAFVLGYPLAQAALIAAGLLLWSRRIRSERFFMRVDWELLVMFSGLFMVT
FT                   AAVKKLGILTLLEPLAATAPGLAGVTVLLSNLISNVPAVLLLYPLIPAGDTQGWLLLAA
FT                   ASTLAGNLTLLGSVANLIVAEAARREGYRLSFGEHLRFGLPLTLITLLVAYAWIYR"
     MELLAYLVLG LTYLGLGLGY WPGYRMNRAA IALTGAAFLI VLGVLNFEEA WRALEPHTLG        60
     FLFGVMVLNA HLAYAGFFQL TLNGLVHLAR SPLGLLVWLT FGTGLLSALF LNDTIAILFT       120
     PLVLALTRTL GLPPVPYLLA LAGATNLGSV ATLTGNPQNI VVGSLSRITY LDFAAALTPV       180
     ALVGLAVQVG LLYALYPAVR SRAPLPPLPP LRFRFNRALL FKGAWITLAL LAAFVLGYPL       240
     AQAALIAAGL LLWSRRIRSE RFFMRVDWEL LVMFSGLFMV TAAVKKLGIL TLLEPLAATA       300
     PGLAGVTVLL SNLISNVPAV LLLYPLIPAG DTQGWLLLAA ASTLAGNLTL LGSVANLIVA       360
     EAARREGYRL SFGEHLRFGL PLTLITLLVA YAWIYR                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page