(data stored in ACNUC7421 zone)

EMBL: CP001743.PE101

CP001743.PE101       Location/Qualifiers
FT   CDS             80343..81008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0102"
FT                   /product="protein of unknown function DUF633"
FT                   /note="PFAM: protein of unknown function DUF633; SPTR:
FT                   A1HPB2 Putative uncharacterized protein; InterPro
FT                   IPR006901; COGs: COG2384 SAM-dependent methyltransferase;
FT                   KEGG: pfl:PFL_2370 hypothetical protein; PFAM: Family of
FT                   unknown function (DUF633)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26883"
FT                   /protein_id="ADD26883.1"
FT                   /translation="MPGFTAKLEPRLEAVAQEISAPTHADIGADHALLPRHLLLSGRVQ
FT                   RVIVVEKHRGPWENSRRALEGLCAEVRLGDGLGPLAPGEADSLSLCGMGARLMVKILSA
FT                   HPERLPPRLVLQPNDSALPLRRWALEAGYALVNEQMVQGFWRYSILTLVRGPCTAYRGL
FT                   PLEAALRYGPLLLKARHPLLWAELQEKQQHLASLPPVKQVQQERVYLEQALALWEQRL"
     MPGFTAKLEP RLEAVAQEIS APTHADIGAD HALLPRHLLL SGRVQRVIVV EKHRGPWENS        60
     RRALEGLCAE VRLGDGLGPL APGEADSLSL CGMGARLMVK ILSAHPERLP PRLVLQPNDS       120
     ALPLRRWALE AGYALVNEQM VQGFWRYSIL TLVRGPCTAY RGLPLEAALR YGPLLLKARH       180
     PLLWAELQEK QQHLASLPPV KQVQQERVYL EQALALWEQR L                           221
//

If you have problems or comments...

PBIL Back to PBIL home page