(data stored in ACNUC7421 zone)

EMBL: CP001743.PE105

CP001743.PE105       Location/Qualifiers
FT   CDS             complement(83442..83807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26887"
FT                   /protein_id="ADD26887.1"
FT                   /translation="MLRPLLLLLLAFALSSCILLVEEDEPRRPVQPVTPVTPVQPSIVT
FT                   PGPGSFTYRCSGGTLVVNYLDSNNLRLFYDGAFQSLSLVRRSPTLLFSGGAYTWEWTGS
FT                   RGTLTVRGQVVLSNCAL"
     MLRPLLLLLL AFALSSCILL VEEDEPRRPV QPVTPVTPVQ PSIVTPGPGS FTYRCSGGTL        60
     VVNYLDSNNL RLFYDGAFQS LSLVRRSPTL LFSGGAYTWE WTGSRGTLTV RGQVVLSNCA       120
     L                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page