(data stored in ACNUC7421 zone)

EMBL: CP001743.PE107

CP001743.PE107       Location/Qualifiers
FT   CDS             complement(84449..85753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0108"
FT                   /product="E3 binding domain protein"
FT                   /note="PFAM: E3 binding domain protein; InterPro IPR004167;
FT                   KEGG: actin binding; SPTR: Q58NA5 Plus agglutinin
FT                   (Fragment); PFAM: e3 binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26889"
FT                   /protein_id="ADD26889.1"
FT                   /translation="MSEVKITPLARRLAEENSIDWRQIKGTGPDGTVVERDILAFLAKV
FT                   MAGEVNLPPTPEEVAPPTGAIPDMAQAQAVLQKEGVQLDDLVPSSPSAPPPPESALPTL
FT                   EDIEFDLDLEPAPPPPVPPASAAFEEAPTLAPEPEIVPNFEEPEPLTSTGPLSTLQWEE
FT                   PEPLSPLPEVNPELASLPPLPSEPDLEPPSSANKLIWETQEVLTAPEVPAPAPEPLAPG
FT                   MSFTNTPEAPSAEPAVPPAPEHQAPVEAAAAPLTPPAASIPTPFANTGLGVGPAPSTQM
FT                   LRVQAWQRLVAIGPAQEAAQTLSEAWRMEVGLDALLYRAADKALSDTQTPLRPTKGHLE
FT                   GNELKSLRVAPAQSLRGTLDSLRMASDPAEGLVVLSLANSAFDQVIFPGLSTLTLGRAS
FT                   GGHALLTLSGDMSSELAGQLLARVAYYLERPILLA"
     MSEVKITPLA RRLAEENSID WRQIKGTGPD GTVVERDILA FLAKVMAGEV NLPPTPEEVA        60
     PPTGAIPDMA QAQAVLQKEG VQLDDLVPSS PSAPPPPESA LPTLEDIEFD LDLEPAPPPP       120
     VPPASAAFEE APTLAPEPEI VPNFEEPEPL TSTGPLSTLQ WEEPEPLSPL PEVNPELASL       180
     PPLPSEPDLE PPSSANKLIW ETQEVLTAPE VPAPAPEPLA PGMSFTNTPE APSAEPAVPP       240
     APEHQAPVEA AAAPLTPPAA SIPTPFANTG LGVGPAPSTQ MLRVQAWQRL VAIGPAQEAA       300
     QTLSEAWRME VGLDALLYRA ADKALSDTQT PLRPTKGHLE GNELKSLRVA PAQSLRGTLD       360
     SLRMASDPAE GLVVLSLANS AFDQVIFPGL STLTLGRASG GHALLTLSGD MSSELAGQLL       420
     ARVAYYLERP ILLA                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page