(data stored in ACNUC7421 zone)

EMBL: CP001743.PE109

CP001743.PE109       Location/Qualifiers
FT   CDS             complement(87023..88699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0110"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART: RNA
FT                   binding S1 domain protein; InterPro IPR000110:IPR003029;
FT                   KEGG: mxa:MXAN_3793 30S ribosomal protein S1; COGs: COG0539
FT                   Ribosomal protein S1; SPTR: A7CXU2 Ribosomal protein S1;
FT                   PFAM: S1 RNA binding domain; TIGRFAM: ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26891"
FT                   /protein_id="ADD26891.1"
FT                   /translation="MEDQATQTPVETGKEPQAFSMEQALQDAEARLEKTVQRGQIVTGT
FT                   VVLVTNDGVMVDIGARTEAVIPFNQLTEENLSEEELKNLLKPGDTVTAYVVRADLENGQ
FT                   VVLSKKRAEADQSWVKIQALYEQGEPVMVQVKEKVKGGLVATIEGLRAFLPASQVDLKR
FT                   TPDLDEYVGQSFLVKIIELNRKKGRIILSRRTVLEAEQKAARSQVLASLKEGEVVEGQV
FT                   VEVTDFGVFVALGGVDGLVHRSEITWGRFNHPRDVVQKGQTVKAKVLSVDTERERVNLS
FT                   MKALTQDPWLTVSEKYPVGSRLTGKVVGLTQFGAFVEVEPGLEGLIHISELSWTKRPKH
FT                   PGEILKEGQEVEAQVLRIDPEERRLSLGLKQTQPDPWKSLPDRYPPGTPVKGKVTGLTD
FT                   FGVFVEIEPGIEGLIHVSELAYERVEKPSEIFKKGDEVEAAILQIDPVEQRISLSRKRL
FT                   LPPPAHAVSIPGGEEGEGRKGRREGKEGERPKRSKGKGGAREGRGRDHDYDYGMGGGAA
FT                   SYTNYDPSVVATSNTNVKLGDVFGDLLSQIALEEDKDKEKA"
     MEDQATQTPV ETGKEPQAFS MEQALQDAEA RLEKTVQRGQ IVTGTVVLVT NDGVMVDIGA        60
     RTEAVIPFNQ LTEENLSEEE LKNLLKPGDT VTAYVVRADL ENGQVVLSKK RAEADQSWVK       120
     IQALYEQGEP VMVQVKEKVK GGLVATIEGL RAFLPASQVD LKRTPDLDEY VGQSFLVKII       180
     ELNRKKGRII LSRRTVLEAE QKAARSQVLA SLKEGEVVEG QVVEVTDFGV FVALGGVDGL       240
     VHRSEITWGR FNHPRDVVQK GQTVKAKVLS VDTERERVNL SMKALTQDPW LTVSEKYPVG       300
     SRLTGKVVGL TQFGAFVEVE PGLEGLIHIS ELSWTKRPKH PGEILKEGQE VEAQVLRIDP       360
     EERRLSLGLK QTQPDPWKSL PDRYPPGTPV KGKVTGLTDF GVFVEIEPGI EGLIHVSELA       420
     YERVEKPSEI FKKGDEVEAA ILQIDPVEQR ISLSRKRLLP PPAHAVSIPG GEEGEGRKGR       480
     REGKEGERPK RSKGKGGARE GRGRDHDYDY GMGGGAASYT NYDPSVVATS NTNVKLGDVF       540
     GDLLSQIALE EDKDKEKA                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page