(data stored in ACNUC7421 zone)

EMBL: CP001743.PE113

CP001743.PE113       Location/Qualifiers
FT   CDS             90898..92259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0114"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; InterPro IPR010256:IPR001905;
FT                   KEGG: scl:sce2376 ammonium transporter; COGs: COG0004
FT                   Ammonia permease; SPTR: Q8PYW6 Ammonium transporter; PFAM:
FT                   Ammonium Transporter Family; TIGRFAM: ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26895"
FT                   /protein_id="ADD26895.1"
FT                   /translation="MKNLRLPFGLAALLGGLAFAQDPEFSAADTAWMLVATGLVLLMTP
FT                   ALAFFYGGMVRSKNALNTMMMSFSALGFVAVAWALLGYTLALSGDGNFIGDLRYLFLNN
FT                   VGMENKGAIVSITIPHMLWMIFQGTFAIITAALISGAVVERMRFPAFLLFITLWSLLVY
FT                   APIAKWVWGGGFLADLGAWDFAGGTVVHINSGIAAVVAALVLGARKDFGRQAVLPHNVP
FT                   FVLLGAALLWFGWFGFNAGSAWAASATAGLALTNTILAPAATIVAWSLIDLMRTGRVTA
FT                   VGLATAIVVGLVVITPAAAFVSPFYALVMGAIGAFPSYFVLLWRARSGMDDSLDVFAAH
FT                   GVGGITGAILTGVFAQKSVNGLFDGLIAGNPAQVLIQAFAVLIAVVYSGAITFVLLKLV
FT                   GAITPLKATIKEEGVGMDVSQHGEEAYTSGEGAILVKSETAMPMARPKPAGGTD"
     MKNLRLPFGL AALLGGLAFA QDPEFSAADT AWMLVATGLV LLMTPALAFF YGGMVRSKNA        60
     LNTMMMSFSA LGFVAVAWAL LGYTLALSGD GNFIGDLRYL FLNNVGMENK GAIVSITIPH       120
     MLWMIFQGTF AIITAALISG AVVERMRFPA FLLFITLWSL LVYAPIAKWV WGGGFLADLG       180
     AWDFAGGTVV HINSGIAAVV AALVLGARKD FGRQAVLPHN VPFVLLGAAL LWFGWFGFNA       240
     GSAWAASATA GLALTNTILA PAATIVAWSL IDLMRTGRVT AVGLATAIVV GLVVITPAAA       300
     FVSPFYALVM GAIGAFPSYF VLLWRARSGM DDSLDVFAAH GVGGITGAIL TGVFAQKSVN       360
     GLFDGLIAGN PAQVLIQAFA VLIAVVYSGA ITFVLLKLVG AITPLKATIK EEGVGMDVSQ       420
     HGEEAYTSGE GAILVKSETA MPMARPKPAG GTD                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page