(data stored in ACNUC7421 zone)

EMBL: CP001743.PE116

CP001743.PE116       Location/Qualifiers
FT   CDS             complement(93543..94655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0117"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; SMART: AAA ATPase; InterPro
FT                   IPR001482:IPR003593:IPR006321; KEGG: ppd:Ppro_3178
FT                   twitching motility protein; COGs: COG2805 Tfp pilus
FT                   assembly protein pilus retraction ATPase PilT; SPTR: A1HQ23
FT                   Twitching motility protein; PFAM: Type II/IV secretion
FT                   system protein; TIGRFAM: pilus retraction protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26898"
FT                   /protein_id="ADD26898.1"
FT                   /translation="MTFPELLASLVAKGVSDIHLHVGLPIMARLHGRLIPITQSPLTPQ
FT                   YTEALVDLMCNERQKALFAERSQVDLAYGVPGVARFRVNLFKQRGSVSCVMRVVNSDES
FT                   KLKIVSLPQDTINYFRDKEKGLVLVTGPTGSGKSTTLARIIDEINQHHSKMIVTLEDPI
FT                   EYLHRSKKSIVVQREIGQDAPSFKDGLVAAMRQDPDVIMIGEIRDHATAAAALEAAQTG
FT                   HLVFSTLHTLDTVRTVNRVLDLFPPHEREVARILFAESLVGIVSQRLLPSKQGGRVCAM
FT                   EILKGNLRIRDLIRDPDRTNEIYEALKDSSLDGMQTFDDHLAELYARDQIDLETALAHA
FT                   TSAQYVKVKALQINAARQTLIDESVVQQSN"
     MTFPELLASL VAKGVSDIHL HVGLPIMARL HGRLIPITQS PLTPQYTEAL VDLMCNERQK        60
     ALFAERSQVD LAYGVPGVAR FRVNLFKQRG SVSCVMRVVN SDESKLKIVS LPQDTINYFR       120
     DKEKGLVLVT GPTGSGKSTT LARIIDEINQ HHSKMIVTLE DPIEYLHRSK KSIVVQREIG       180
     QDAPSFKDGL VAAMRQDPDV IMIGEIRDHA TAAAALEAAQ TGHLVFSTLH TLDTVRTVNR       240
     VLDLFPPHER EVARILFAES LVGIVSQRLL PSKQGGRVCA MEILKGNLRI RDLIRDPDRT       300
     NEIYEALKDS SLDGMQTFDD HLAELYARDQ IDLETALAHA TSAQYVKVKA LQINAARQTL       360
     IDESVVQQSN                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page