(data stored in ACNUC7421 zone)

EMBL: CP001743.PE117

CP001743.PE117       Location/Qualifiers
FT   CDS             94902..95336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0118"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; SPTR: Q8PYN7 Universal
FT                   stress protein; InterPro IPR006015:IPR006016; COGs: COG0589
FT                   Universal stress protein UspA and related
FT                   nucleotide-binding protein; KEGG: pol:Bpro_1197 UspA; PFAM:
FT                   Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26899"
FT                   /protein_id="ADD26899.1"
FT                   /translation="MYKRILMPTDGSNCSQQAIREGLEVAKNMGARVTFLYALENISSS
FT                   FWISPESVPYGLELLEDLKRVGNEALSKASELAQAAGVEAETKLVEARPVEAILDEAKN
FT                   HDLVVMGTHGRSGLDRFMLGSVTEAVLHRSERPVLVLRCK"
     MYKRILMPTD GSNCSQQAIR EGLEVAKNMG ARVTFLYALE NISSSFWISP ESVPYGLELL        60
     EDLKRVGNEA LSKASELAQA AGVEAETKLV EARPVEAILD EAKNHDLVVM GTHGRSGLDR       120
     FMLGSVTEAV LHRSERPVLV LRCK                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page