(data stored in ACNUC7421 zone)

EMBL: CP001743.PE12

CP001743.PE12        Location/Qualifiers
FT   CDS             12401..12622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26794"
FT                   /protein_id="ADD26794.1"
FT                   /translation="MAKLVRKYNPYTNKFEMVPEDWVLRYNPFQNRHEFAPADNRFSYL
FT                   PTNGEFSAIPAPPKYNPHQETFSPGKRD"
     MAKLVRKYNP YTNKFEMVPE DWVLRYNPFQ NRHEFAPADN RFSYLPTNGE FSAIPAPPKY        60
     NPHQETFSPG KRD                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page