(data stored in ACNUC7421 zone)

EMBL: CP001743.PE120

CP001743.PE120       Location/Qualifiers
FT   CDS             99554..99808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26902"
FT                   /protein_id="ADD26902.1"
FT                   /translation="MQYFKSSAQGAKHWLEMIRDKAPSWTGLPVGDEGGLMRPDQSASY
FT                   NLVFRYREYAFLLSNHPDDSPAFYRKWAQAIIQRIQRFK"
     MQYFKSSAQG AKHWLEMIRD KAPSWTGLPV GDEGGLMRPD QSASYNLVFR YREYAFLLSN        60
     HPDDSPAFYR KWAQAIIQRI QRFK                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page