(data stored in ACNUC7421 zone)

EMBL: CP001743.PE122

CP001743.PE122       Location/Qualifiers
FT   CDS             101137..103350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_00157 QXW lectin repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26904"
FT                   /protein_id="ADD26904.1"
FT                   /translation="MGWQNFASTLWLRWIIVVLILGLPACSGTPPDPRAREAIIPATTK
FT                   VSDPSTRDALTLYDPETGILRFSTSTPLLDSLKIDNVLVSEPSSAAPYGYLRKIKAIRR
FT                   EGAQVVLETVQANLTDAIHQGWLEAADDLEASDLASAMALVEGLSVGVVQPTANVGDGF
FT                   RFEARFDETVLDINEGDVRVKVRVNGVFYFNAGYNIAVGIKPRFGIPPAYVDHFEAWIG
FT                   FEQRAQLQVSGEANAQVNKEKKVAEYRFKPLCFAIGPVPVCVVPTVYIFVGATGEVNLR
FT                   FSYNAVQTAQAKMGARWTDSRGWEEIEPTPAFNTSFDQNFDINAGLKTRAYTKAEGALM
FT                   LYGIAGPTIGAQMSIELDVAVPRDPFWILRGSLRAYYSFIVDIPVIGRVAEHSGTLYEI
FT                   GREFGRSPAPPPTITIRTSPATVQLRVETDLAQFFRVAHPLGNVDLTVTSNLDGTLYSG
FT                   SWSTNPNSLFGPELKRTFNTVGSRTLTLIARYVNSQTSSSLVLDVVNTPPTLNLQYGGD
FT                   PRQGQIYPITVLITDPNEPDTTRLCGSTQWSVEAPDTLSATTGCSVSVTFGTTGARQIR
FT                   VTARDSEGATTTRTLTLDVLPPPVNPYPKITGYGVYSDEYTGGPIRCGSVRVADGRTID
FT                   LNNRGCVTPHRYYGGITVENPSNEALTYDWKLYVSPPGFDNLLLSETASTSYIFELYNV
FT                   HNSGLTTNDCRVTVKVNAPDPSRSKGPITVWTGRCTYYSFTLR"
     MGWQNFASTL WLRWIIVVLI LGLPACSGTP PDPRAREAII PATTKVSDPS TRDALTLYDP        60
     ETGILRFSTS TPLLDSLKID NVLVSEPSSA APYGYLRKIK AIRREGAQVV LETVQANLTD       120
     AIHQGWLEAA DDLEASDLAS AMALVEGLSV GVVQPTANVG DGFRFEARFD ETVLDINEGD       180
     VRVKVRVNGV FYFNAGYNIA VGIKPRFGIP PAYVDHFEAW IGFEQRAQLQ VSGEANAQVN       240
     KEKKVAEYRF KPLCFAIGPV PVCVVPTVYI FVGATGEVNL RFSYNAVQTA QAKMGARWTD       300
     SRGWEEIEPT PAFNTSFDQN FDINAGLKTR AYTKAEGALM LYGIAGPTIG AQMSIELDVA       360
     VPRDPFWILR GSLRAYYSFI VDIPVIGRVA EHSGTLYEIG REFGRSPAPP PTITIRTSPA       420
     TVQLRVETDL AQFFRVAHPL GNVDLTVTSN LDGTLYSGSW STNPNSLFGP ELKRTFNTVG       480
     SRTLTLIARY VNSQTSSSLV LDVVNTPPTL NLQYGGDPRQ GQIYPITVLI TDPNEPDTTR       540
     LCGSTQWSVE APDTLSATTG CSVSVTFGTT GARQIRVTAR DSEGATTTRT LTLDVLPPPV       600
     NPYPKITGYG VYSDEYTGGP IRCGSVRVAD GRTIDLNNRG CVTPHRYYGG ITVENPSNEA       660
     LTYDWKLYVS PPGFDNLLLS ETASTSYIFE LYNVHNSGLT TNDCRVTVKV NAPDPSRSKG       720
     PITVWTGRCT YYSFTLR                                                      737
//

If you have problems or comments...

PBIL Back to PBIL home page