(data stored in ACNUC7421 zone)

EMBL: CP001743.PE124

CP001743.PE124       Location/Qualifiers
FT   CDS             104133..104729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0126"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="KEGG: AGAP009786-PA; COGs: COG0299 Folate-dependent
FT                   phosphoribosylglycinamide formyltransferase PurN; SPTR:
FT                   Q7Q1H5 AGAP009786-PA; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   InterPro IPR002376:IPR001555:IPR004607; PFAM: Formyl
FT                   transferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase, formyltetrahydrofolate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26906"
FT                   /protein_id="ADD26906.1"
FT                   /translation="MSYFPLGRPARMAVMASGRGSNLEALLKAFPHDNPLGHIVLVISD
FT                   RREALALQKAVEAQIEAEYVPWPKERGREQFERVAGQLLRDHRIDLVLLAGFMRLLSPG
FT                   FVQAWEGRILNIHPSLLPQFPGLHAQRQALEAGVSETGCTVHFVDAGMDTGPIVLQRRV
FT                   PVLPGDTEETLAARILEQEHLAYPEAVRRVLKGEI"
     MSYFPLGRPA RMAVMASGRG SNLEALLKAF PHDNPLGHIV LVISDRREAL ALQKAVEAQI        60
     EAEYVPWPKE RGREQFERVA GQLLRDHRID LVLLAGFMRL LSPGFVQAWE GRILNIHPSL       120
     LPQFPGLHAQ RQALEAGVSE TGCTVHFVDA GMDTGPIVLQ RRVPVLPGDT EETLAARILE       180
     QEHLAYPEAV RRVLKGEI                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page