(data stored in ACNUC7421 zone)

EMBL: CP001743.PE125

CP001743.PE125       Location/Qualifiers
FT   CDS             104800..106041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0127"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine/glycine ligase; PRIAM:
FT                   Phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201; InterPro IPR003806:IPR000115:IPR011761;
FT                   KEGG: pca:Pcar_2231 phosphoribosylamine--glycine ligase;
FT                   COGs: COG0151 Phosphoribosylamine-glycine ligase; SPTR:
FT                   A1HSW5 Phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N domain;
FT                   Phosphoribosylglycinamide synthetase, C domain; TIGRFAM:
FT                   phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26907"
FT                   /protein_id="ADD26907.1"
FT                   /translation="MKVLVVGSGGREHAICWKVAQSPLVSQLYAAPGNPGMAELAECVP
FT                   WDGNVRGLAEWALQEGIELTLVGPEGPLVEGIADAFLEKGLKIFGPTQQAAMIEGSKAF
FT                   AKGLMTRFGIPTAKHRSFSDVLDALAYLEAVGAPIVVKDSGLAAGKGVTVATSLQQAKQ
FT                   AVTNILSGPERAEIVIEEFLSGSEVTVLAVTDGVTIKPLLPSQDHKRLLDGDTGPMTGG
FT                   MGAICPYPLAPGLMTEIVERVLKPLVDGLRAEGIVYKGVIYAGLMLTDDGPKVLEFNAR
FT                   FGDPECQAILPLLETDLVELALAVVEGRLHELEIRWRAQASACVVMAAPGYPDDPHKGL
FT                   PLSLPQLPPEQVLYFQAGTRRGPQGLVTNGGRVLSVVGLGRDLREALERAYAGVGAVRF
FT                   EHALYRRDIGRKVI"
     MKVLVVGSGG REHAICWKVA QSPLVSQLYA APGNPGMAEL AECVPWDGNV RGLAEWALQE        60
     GIELTLVGPE GPLVEGIADA FLEKGLKIFG PTQQAAMIEG SKAFAKGLMT RFGIPTAKHR       120
     SFSDVLDALA YLEAVGAPIV VKDSGLAAGK GVTVATSLQQ AKQAVTNILS GPERAEIVIE       180
     EFLSGSEVTV LAVTDGVTIK PLLPSQDHKR LLDGDTGPMT GGMGAICPYP LAPGLMTEIV       240
     ERVLKPLVDG LRAEGIVYKG VIYAGLMLTD DGPKVLEFNA RFGDPECQAI LPLLETDLVE       300
     LALAVVEGRL HELEIRWRAQ ASACVVMAAP GYPDDPHKGL PLSLPQLPPE QVLYFQAGTR       360
     RGPQGLVTNG GRVLSVVGLG RDLREALERA YAGVGAVRFE HALYRRDIGR KVI              413
//

If you have problems or comments...

PBIL Back to PBIL home page