(data stored in ACNUC7421 zone)

EMBL: CP001743.PE131

CP001743.PE131       Location/Qualifiers
FT   CDS             complement(110661..110993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0133"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; InterPro IPR000100; KEGG:
FT                   azo:azo3991 ribonuclease P; COGs: COG0594 RNase P protein
FT                   component; SPTR: Q7X5K8 Ribonuclease P protein component;
FT                   PFAM: Ribonuclease P; TIGRFAM: ribonuclease P protein
FT                   component, eubacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26913"
FT                   /protein_id="ADD26913.1"
FT                   /translation="MPFSSLKGEKAFQRLRGGRVGRGKYLTVRWFPLRPTAFNPVRVGI
FT                   VVSNKVSKKATVRNKIRRRLREILRKMHLPPCEMVVVAQPEAVEASYWDLLKDLTHALK
FT                   KSGLVQ"
     MPFSSLKGEK AFQRLRGGRV GRGKYLTVRW FPLRPTAFNP VRVGIVVSNK VSKKATVRNK        60
     IRRRLREILR KMHLPPCEMV VVAQPEAVEA SYWDLLKDLT HALKKSGLVQ                  110
//

If you have problems or comments...

PBIL Back to PBIL home page