(data stored in ACNUC7421 zone)

EMBL: CP001743.PE133

CP001743.PE133       Location/Qualifiers
FT   CDS             111525..112292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0135"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593; KEGG: met:M446_2309 ABC
FT                   transporter related; COGs: COG0411 ABC-type branched-chain
FT                   amino acid transport systems ATPase component; SPTR: A0NNM9
FT                   ABC branched amino acid transporter family, ATPase subunit;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26915"
FT                   /protein_id="ADD26915.1"
FT                   /translation="MQLKVERVSLNFGGVKALSEVSLEVAQGELVSVIGPNGAGKTSLL
FT                   NCISGFYHPSAGKITFEGHDLTHASPHQVTKFGIARAFQNIELFTGMSVLENLLMARHT
FT                   FGHYNLLDNILIYGRAMRVGVENRRFCEEIIDFMELEPYRKALVGDLPYGVRKRVEVAR
FT                   ALALSPKLLLLDEPMAGMTLEEKEDMVRFILDIRAERGTTIILIEHDLGVVMDISDRVY
FT                   VLDFGQVIASGLPEEVSQNPRVQEAYVGVDHAV"
     MQLKVERVSL NFGGVKALSE VSLEVAQGEL VSVIGPNGAG KTSLLNCISG FYHPSAGKIT        60
     FEGHDLTHAS PHQVTKFGIA RAFQNIELFT GMSVLENLLM ARHTFGHYNL LDNILIYGRA       120
     MRVGVENRRF CEEIIDFMEL EPYRKALVGD LPYGVRKRVE VARALALSPK LLLLDEPMAG       180
     MTLEEKEDMV RFILDIRAER GTTIILIEHD LGVVMDISDR VYVLDFGQVI ASGLPEEVSQ       240
     NPRVQEAYVG VDHAV                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page