(data stored in ACNUC7421 zone)

EMBL: CP001743.PE134

CP001743.PE134       Location/Qualifiers
FT   CDS             112356..114296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0136"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; SPTR:
FT                   A4TXS6 AMP-dependent synthetase and ligase; InterPro
FT                   IPR000873; COGs: COG1022 Long-chain acyl-CoA synthetase
FT                   (AMP-forming); KEGG: dal:Dalk_3803 AMP-dependent synthetase
FT                   and ligase; PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26916"
FT                   /protein_id="ADD26916.1"
FT                   /translation="MMPSGYELKKYTLPQVLQMRAKAMPKQVAIREKDLGIWNEITFAD
FT                   YYRHVTRFAAGLLALGFEKGERLAVIADNIPEWLYAELATQALGGISVGVYQSSLPPEI
FT                   AYVLSYTGAAFVVAEDQEQVDKLLEIRSEIPSVRKVIYEDPKGMRAYRDDPWIIGFDEV
FT                   ERLGEEYLQKHPQAVEERIAQGHPEDVCHLSLTSGTTGRPKAAMLRHRNLLHMGVALQE
FT                   IDPLKPTDDYLSFLPFAWIGEQMMSVGMALAGGFAVNMPESVETAMSDLKEIGPHVMFS
FT                   PPRVWEGTQSQIWVRISETYAFNRWVYQQMLKIGYRAADYRMRGRPMPLGLRLAYWFAD
FT                   QIMFKPLRDQLGFLRLRRAYTGGAALGPDVFRFYHAIGVNLKQIYGQTEIIGIAFVHRD
FT                   GDVRADTVGLPIPGGEVKISERGEILCRSDAVVAGYWQNPEATAETFADGWLHTGDAGY
FT                   LTPEGHLVVIDRVSDVMHTSAQQMFSPQFIENKLKFSPYIKEAVVFGDQKPFLTAFINV
FT                   DPQTVGKWAEDRRIAYTTYIDLSQKPQVAELIRKEVQRVNEGLPEHLRIQRFVLLYKLL
FT                   DADDDELTRTGKVRRKFIMQRYQPIVDALYSGTDKVQVDTEFKYQDGTVQKVSVEVRVL
FT                   EADGKPEIVGV"
     MMPSGYELKK YTLPQVLQMR AKAMPKQVAI REKDLGIWNE ITFADYYRHV TRFAAGLLAL        60
     GFEKGERLAV IADNIPEWLY AELATQALGG ISVGVYQSSL PPEIAYVLSY TGAAFVVAED       120
     QEQVDKLLEI RSEIPSVRKV IYEDPKGMRA YRDDPWIIGF DEVERLGEEY LQKHPQAVEE       180
     RIAQGHPEDV CHLSLTSGTT GRPKAAMLRH RNLLHMGVAL QEIDPLKPTD DYLSFLPFAW       240
     IGEQMMSVGM ALAGGFAVNM PESVETAMSD LKEIGPHVMF SPPRVWEGTQ SQIWVRISET       300
     YAFNRWVYQQ MLKIGYRAAD YRMRGRPMPL GLRLAYWFAD QIMFKPLRDQ LGFLRLRRAY       360
     TGGAALGPDV FRFYHAIGVN LKQIYGQTEI IGIAFVHRDG DVRADTVGLP IPGGEVKISE       420
     RGEILCRSDA VVAGYWQNPE ATAETFADGW LHTGDAGYLT PEGHLVVIDR VSDVMHTSAQ       480
     QMFSPQFIEN KLKFSPYIKE AVVFGDQKPF LTAFINVDPQ TVGKWAEDRR IAYTTYIDLS       540
     QKPQVAELIR KEVQRVNEGL PEHLRIQRFV LLYKLLDADD DELTRTGKVR RKFIMQRYQP       600
     IVDALYSGTD KVQVDTEFKY QDGTVQKVSV EVRVLEADGK PEIVGV                      646
//

If you have problems or comments...

PBIL Back to PBIL home page