(data stored in ACNUC7421 zone)

EMBL: CP001743.PE136

CP001743.PE136       Location/Qualifiers
FT   CDS             115246..116322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0138"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; SPTR: A6EZ42
FT                   Inner-membrane translocator; InterPro IPR001851; COGs:
FT                   COG4177 ABC-type branched-chain amino acid transport system
FT                   permease component; KEGG: bpt:Bpet1128 high-affinity
FT                   branched-chain amino acid transport system permease
FT                   protein; PFAM: Branched-chain amino acid transport system /
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26918"
FT                   /protein_id="ADD26918.1"
FT                   /translation="MRNPWAQTGNYRTSYVQDTTIFANYREIVSVVLLLVGLCILPLFL
FT                   ERSQVLVLNFILIYAIAVLGLNITTGYAGLISVGQAAFMGVGAYTVALSAPSLPFWLTI
FT                   PLGGFTAAIIGFIVGIPSLRVKHLYLVLATLAFQEIFVWVVGRSPALAQGAAIPVEMRN
FT                   FLGLEIGFRNHNYFWYYVILFVLVLMVMAWRNLLRGKYGRALIAVRDNDRAADAMGMDP
FT                   GRTKLMAFALGAFYGGVAGGLLAYMQRAVVVEEFTLSRSVALLAMAIVGGLGTVVGSLL
FT                   GPAFIEFLRLYVERLSEWMKSNAFIQSITPAGVDVASALLPLSFGLVIVLFLIFEPRGL
FT                   YNWWRLLRSYFRTWPFRY"
     MRNPWAQTGN YRTSYVQDTT IFANYREIVS VVLLLVGLCI LPLFLERSQV LVLNFILIYA        60
     IAVLGLNITT GYAGLISVGQ AAFMGVGAYT VALSAPSLPF WLTIPLGGFT AAIIGFIVGI       120
     PSLRVKHLYL VLATLAFQEI FVWVVGRSPA LAQGAAIPVE MRNFLGLEIG FRNHNYFWYY       180
     VILFVLVLMV MAWRNLLRGK YGRALIAVRD NDRAADAMGM DPGRTKLMAF ALGAFYGGVA       240
     GGLLAYMQRA VVVEEFTLSR SVALLAMAIV GGLGTVVGSL LGPAFIEFLR LYVERLSEWM       300
     KSNAFIQSIT PAGVDVASAL LPLSFGLVIV LFLIFEPRGL YNWWRLLRSY FRTWPFRY         358
//

If you have problems or comments...

PBIL Back to PBIL home page