(data stored in ACNUC7421 zone)

EMBL: CP001743.PE138

CP001743.PE138       Location/Qualifiers
FT   CDS             117668..118486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0140"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593:IPR017871; KEGG: mag:amb3593
FT                   ABC-type branched-chain amino acid transport systems,
FT                   ATPase component; COGs: COG0410 ABC-type branched-chain
FT                   amino acid transport systems ATPase component; SPTR: A4TXT0
FT                   Branched chain amino acid ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26920"
FT                   /protein_id="ADD26920.1"
FT                   /translation="MRPEDLGNILLEVNNIEVVYKDIIQVLRGVSLKVPEGQITALLGP
FT                   NGAGKTTTLRAISGLLVPEDGKVVSGSILYRGENIANKPPEQIVLKGIVQVPEGRRVFK
FT                   HLTVEENLRVGAVTRRDGAKVREDLERIYHYFPKLALIRTRLAGYCSGGEQQMLAIGRA
FT                   LLANPKLLLLDEPSLGLAPLLVREIFDIVAQINAEEGVTVLVVEQNARVALSVAHYGYI
FT                   MESGRIALEGTREYLETNPDVKEFYLGVAKSGGRKSFKDVKSYRRRKRFM"
     MRPEDLGNIL LEVNNIEVVY KDIIQVLRGV SLKVPEGQIT ALLGPNGAGK TTTLRAISGL        60
     LVPEDGKVVS GSILYRGENI ANKPPEQIVL KGIVQVPEGR RVFKHLTVEE NLRVGAVTRR       120
     DGAKVREDLE RIYHYFPKLA LIRTRLAGYC SGGEQQMLAI GRALLANPKL LLLDEPSLGL       180
     APLLVREIFD IVAQINAEEG VTVLVVEQNA RVALSVAHYG YIMESGRIAL EGTREYLETN       240
     PDVKEFYLGV AKSGGRKSFK DVKSYRRRKR FM                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page