(data stored in ACNUC7421 zone)

EMBL: CP001743.PE14

CP001743.PE14        Location/Qualifiers
FT   CDS             complement(13538..14296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26796"
FT                   /protein_id="ADD26796.1"
FT                   /translation="MPWQYVPLLHHLEELYRKPRDLTRFRAYLAKVLNAQGDDVELVPL
FT                   IAANPMAKEHALAYVQELLALQAEALAQAAMEEAAQQLPPVQAQLKVSLTVLDDARGGW
FT                   THRYTTQKGLWGLSERELALAHRYGWVSIPCWTSEKPSPEYIRQQTRLHLYQAAWSYHQ
FT                   AIPKTLREILVYEGQALRFAGAVQWLDDEELAYTRAVLEPHLDSTHYPTLLVALEGDPA
FT                   AQALGYPPLGLSPKAGLALALAEATTHNSS"
     MPWQYVPLLH HLEELYRKPR DLTRFRAYLA KVLNAQGDDV ELVPLIAANP MAKEHALAYV        60
     QELLALQAEA LAQAAMEEAA QQLPPVQAQL KVSLTVLDDA RGGWTHRYTT QKGLWGLSER       120
     ELALAHRYGW VSIPCWTSEK PSPEYIRQQT RLHLYQAAWS YHQAIPKTLR EILVYEGQAL       180
     RFAGAVQWLD DEELAYTRAV LEPHLDSTHY PTLLVALEGD PAAQALGYPP LGLSPKAGLA       240
     LALAEATTHN SS                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page