(data stored in ACNUC7421 zone)

EMBL: CP001743.PE140

CP001743.PE140       Location/Qualifiers
FT   CDS             complement(119005..119424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26922"
FT                   /protein_id="ADD26922.1"
FT                   /translation="MVAMEIVGLRGAPQETLRALKEALKGVSFPEALAIYITDWQDQRA
FT                   QARFALFVRQGKHRVLSRDAFGPRFGLEGDAALKDLTLWLIERGVTDFKEAVVAPSEFA
FT                   ALFELEAEEAQKLIMASANPTDPMLYIKREFTSRM"
     MVAMEIVGLR GAPQETLRAL KEALKGVSFP EALAIYITDW QDQRAQARFA LFVRQGKHRV        60
     LSRDAFGPRF GLEGDAALKD LTLWLIERGV TDFKEAVVAP SEFAALFELE AEEAQKLIMA       120
     SANPTDPMLY IKREFTSRM                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page