(data stored in ACNUC7421 zone)

EMBL: CP001743.PE145

CP001743.PE145       Location/Qualifiers
FT   CDS             125034..125972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0147"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; SPTR: A3YCI8 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119; COGs: COG0583 Transcriptional
FT                   regulator; KEGG: transcriptional regulator protein; PFAM:
FT                   LysR substrate binding domain; Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26927"
FT                   /protein_id="ADD26927.1"
FT                   /translation="MQISLKQLVYFIAVAESGSISKALTSLNVTQSVVTEAIKKLEETL
FT                   GAELFTRHARGMILTHAGHQFLRHAHEVLAALRNAEQAIRERPDATTGQLNLGVTSLVT
FT                   AYYLPYLLDRFERVFPGVQVAVVEDRRGYIEHLLINGELDVAVMNVSMVDKQALETRTL
FT                   LRAPWRVWLPTNHPLVQQEAVSLENLREERFLYLKNDELEEVTQQIYRLSGFPRVAVRT
FT                   DSIEAMRSLVALGIGVAVLPNLMYRPWSLEGDRLESRPLLENLPRLEIGVAWRRGSALS
FT                   EAARQFLVVVGEHSRVQTYGISYSDLLSPAE"
     MQISLKQLVY FIAVAESGSI SKALTSLNVT QSVVTEAIKK LEETLGAELF TRHARGMILT        60
     HAGHQFLRHA HEVLAALRNA EQAIRERPDA TTGQLNLGVT SLVTAYYLPY LLDRFERVFP       120
     GVQVAVVEDR RGYIEHLLIN GELDVAVMNV SMVDKQALET RTLLRAPWRV WLPTNHPLVQ       180
     QEAVSLENLR EERFLYLKND ELEEVTQQIY RLSGFPRVAV RTDSIEAMRS LVALGIGVAV       240
     LPNLMYRPWS LEGDRLESRP LLENLPRLEI GVAWRRGSAL SEAARQFLVV VGEHSRVQTY       300
     GISYSDLLSP AE                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page