(data stored in ACNUC7421 zone)

EMBL: CP001743.PE147

CP001743.PE147       Location/Qualifiers
FT   CDS             127455..128486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0149"
FT                   /product="ABC transporter related protein"
FT                   /EC_number="3.6.3.30"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; InterPro
FT                   IPR003439:IPR013611:IPR003593:IPR017871; KEGG:
FT                   pen:PSEEN1241 ABC transporter, ATP-binding protein; COGs:
FT                   COG3842 ABC-type spermidine/putrescine transport systems
FT                   ATPase components; SPTR: P77795 Uncharacterized ABC
FT                   transporter ATP-binding protein ydcT; PFAM: ABC
FT                   transporter; TOBE domain; TIGRFAM: spermidine/putrescine
FT                   ABC transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26929"
FT                   /protein_id="ADD26929.1"
FT                   /translation="MVQMYKEPETQSVQAAVELRGVSCYFGPVKAVDGVDLEILPGEFF
FT                   SMLGPSGSGKTTCLRLIGGFEQPTAGQIVLFGQDASKLPPYARDVNTVFQDYALFPHMN
FT                   VRDNVAYALMVRGVPKPERHRRAEEMLELVKLSGLGDRRPGQLSGGQRQRVALARALIN
FT                   RPRLLLLDEPLGALDLKLREEMQIELKALQRQLGITFIYVTHDQGEALSMSDRVAVFNH
FT                   GKIEQLDNPKTLYEYPKTEFVARFVGSANVLEGRLLGLGTGKYALRPERIAIQAGSHNG
FT                   PNSLCGTLLDIHYLGAQTRYEVQVGNERLTVLTSSEEQGLQVGGAVTLRWEHSALRPLQ
FT                   EVS"
     MVQMYKEPET QSVQAAVELR GVSCYFGPVK AVDGVDLEIL PGEFFSMLGP SGSGKTTCLR        60
     LIGGFEQPTA GQIVLFGQDA SKLPPYARDV NTVFQDYALF PHMNVRDNVA YALMVRGVPK       120
     PERHRRAEEM LELVKLSGLG DRRPGQLSGG QRQRVALARA LINRPRLLLL DEPLGALDLK       180
     LREEMQIELK ALQRQLGITF IYVTHDQGEA LSMSDRVAVF NHGKIEQLDN PKTLYEYPKT       240
     EFVARFVGSA NVLEGRLLGL GTGKYALRPE RIAIQAGSHN GPNSLCGTLL DIHYLGAQTR       300
     YEVQVGNERL TVLTSSEEQG LQVGGAVTLR WEHSALRPLQ EVS                         343
//

If you have problems or comments...

PBIL Back to PBIL home page