(data stored in ACNUC7421 zone)

EMBL: CP001743.PE149

CP001743.PE149       Location/Qualifiers
FT   CDS             129439..130248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0151"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: P0AFS0 Inner membrane ABC
FT                   transporter permease protein ydcV; InterPro IPR000515;
FT                   COGs: COG1177 ABC-type spermidine/putrescine transport
FT                   system permease component II; KEGG: pen:PSEEN1239 ABC
FT                   transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26931"
FT                   /protein_id="ADD26931.1"
FT                   /translation="MPGKPSLGLRLAFYLGMLFLHFPILIIVLYALTTEDRTYQFPPPG
FT                   LTLRWFGEAFQRQDMWAALWLSLKVAAMATAIALVLGTMVAAAMYRFQFWGKDFITVLL
FT                   ILPIALPGILTGIALLTTFKRLALEPGFWTIVIGHATFCIVTVYNNVVARFRRTGYSQI
FT                   EASMDLGADWFTTWRMVVLPSIATALLAGGMLSFALSFDEVIVTTFTAADQKTLPIWFL
FT                   NELFRPRERPITNVVAVFVMLITFLPIVLAQWLTRDTDDLHGGGKTG"
     MPGKPSLGLR LAFYLGMLFL HFPILIIVLY ALTTEDRTYQ FPPPGLTLRW FGEAFQRQDM        60
     WAALWLSLKV AAMATAIALV LGTMVAAAMY RFQFWGKDFI TVLLILPIAL PGILTGIALL       120
     TTFKRLALEP GFWTIVIGHA TFCIVTVYNN VVARFRRTGY SQIEASMDLG ADWFTTWRMV       180
     VLPSIATALL AGGMLSFALS FDEVIVTTFT AADQKTLPIW FLNELFRPRE RPITNVVAVF       240
     VMLITFLPIV LAQWLTRDTD DLHGGGKTG                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page