(data stored in ACNUC7421 zone)

EMBL: CP001743.PE15

CP001743.PE15        Location/Qualifiers
FT   CDS             14322..14795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26797"
FT                   /protein_id="ADD26797.1"
FT                   /translation="MAGIALLELMLLLLAVGLLLWVFGASRNLPPAQEEQAHRLEAALA
FT                   EIGRLGGRLPHLHDALKPAQQYGRDLRKLLPQLAELERFLAKPSTEGPTRDRLLVRHHE
FT                   LLQGFERGVEYLERLGAELLLISGSEEPPALAELPQLLIELREILHPLSPTRG"
     MAGIALLELM LLLLAVGLLL WVFGASRNLP PAQEEQAHRL EAALAEIGRL GGRLPHLHDA        60
     LKPAQQYGRD LRKLLPQLAE LERFLAKPST EGPTRDRLLV RHHELLQGFE RGVEYLERLG       120
     AELLLISGSE EPPALAELPQ LLIELREILH PLSPTRG                                157
//

If you have problems or comments...

PBIL Back to PBIL home page