(data stored in ACNUC7421 zone)

EMBL: CP001743.PE151

CP001743.PE151       Location/Qualifiers
FT   CDS             131800..132405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0153"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   InterPro IPR006674:IPR003607; KEGG: bra:BRADO3875 putative
FT                   guanosine polyphosphate pyrophosphohydrolases/synthetases;
FT                   COGs: COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase; SPTR: A0YYY4 Putative
FT                   uncharacterized protein; PFAM: HD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26933"
FT                   /protein_id="ADD26933.1"
FT                   /translation="MELTNRYAEALELAYELHKHQYRKGTEIPYLSHLLAVSALVMEHG
FT                   GGEDEAIAALLHDAVEDAGKVLQSEAGVRVLEHIRQRFGEAVAQIVRECSDTETEPKPP
FT                   YLERKQAYLRHLTEASPPARLVSAADKLHNLRAIVADYRTHGEALWQRFVSEAETIEEK
FT                   RRLTLWYYRELAKEFSSDGGSRLIGAELERLLSGFDGM"
     MELTNRYAEA LELAYELHKH QYRKGTEIPY LSHLLAVSAL VMEHGGGEDE AIAALLHDAV        60
     EDAGKVLQSE AGVRVLEHIR QRFGEAVAQI VRECSDTETE PKPPYLERKQ AYLRHLTEAS       120
     PPARLVSAAD KLHNLRAIVA DYRTHGEALW QRFVSEAETI EEKRRLTLWY YRELAKEFSS       180
     DGGSRLIGAE LERLLSGFDG M                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page