(data stored in ACNUC7421 zone)

EMBL: CP001743.PE154

CP001743.PE154       Location/Qualifiers
FT   CDS             135737..136183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26936"
FT                   /protein_id="ADD26936.1"
FT                   /translation="MKFYRLFPLLAIALVGCQLSYYVSVTEVEYTSKGVCSGVELTTNN
FT                   QKITGIGYLYRTEGRADSVRLTPGQPVRIPDPNPEPRRTSYILGFDGPVRNSAEVDLTW
FT                   RCLPDKQPLGVQFTYYGGQSTIKGLRITENPASPHGFDIEVVDF"
     MKFYRLFPLL AIALVGCQLS YYVSVTEVEY TSKGVCSGVE LTTNNQKITG IGYLYRTEGR        60
     ADSVRLTPGQ PVRIPDPNPE PRRTSYILGF DGPVRNSAEV DLTWRCLPDK QPLGVQFTYY       120
     GGQSTIKGLR ITENPASPHG FDIEVVDF                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page