(data stored in ACNUC7421 zone)

EMBL: CP001743.PE157

CP001743.PE157       Location/Qualifiers
FT   CDS             complement(138066..138902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0159"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; InterPro
FT                   IPR013105:IPR013026; KEGG: pca:Pcar_1474 hypothetical
FT                   protein; SPTR: A3ZQA2 Putative uncharacterized protein;
FT                   PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26939"
FT                   /protein_id="ADD26939.1"
FT                   /translation="MPRTAKTPKPDRLAELRLEARRVLHAALDLEAEQATPEAAYRSQE
FT                   LFYGAMQLSREDAVIKRCIKALRINPNNPDPMLLLARFVGGSPDEQIALHERIVLAGER
FT                   DLGKKNIEIFKGHFWGFVETRPYMRALHTLARLYEKAGQLPKAVQIYEQMLKLNPNDNQ
FT                   GVRYALLGHYLALNKLGDARKLWNRYDQEHSAFWAWGKVLLEFLAGNLEAAQEALGVAR
FT                   KINPHAESYLGGWKPLPKELPGFYSPGQDSEAIYCFVELGAAWVKNPHAQRWLEQH"
     MPRTAKTPKP DRLAELRLEA RRVLHAALDL EAEQATPEAA YRSQELFYGA MQLSREDAVI        60
     KRCIKALRIN PNNPDPMLLL ARFVGGSPDE QIALHERIVL AGERDLGKKN IEIFKGHFWG       120
     FVETRPYMRA LHTLARLYEK AGQLPKAVQI YEQMLKLNPN DNQGVRYALL GHYLALNKLG       180
     DARKLWNRYD QEHSAFWAWG KVLLEFLAGN LEAAQEALGV ARKINPHAES YLGGWKPLPK       240
     ELPGFYSPGQ DSEAIYCFVE LGAAWVKNPH AQRWLEQH                               278
//

If you have problems or comments...

PBIL Back to PBIL home page