(data stored in ACNUC7421 zone)

EMBL: CP001743.PE159

CP001743.PE159       Location/Qualifiers
FT   CDS             complement(140567..142084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0161"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   SPTR: A5WXX3 AgaA; InterPro IPR000914; COGs: COG0747
FT                   ABC-type dipeptide transport system periplasmic component;
FT                   KEGG: bxe:Bxe_B1961 ABC peptide transporter, periplasmic
FT                   ligand binding protein; PFAM: Bacterial extracellular
FT                   solute-binding proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26941"
FT                   /protein_id="ADD26941.1"
FT                   /translation="MKKLLVLLVLVLATVSLAQKAGGILRAGMQTDPVGLDPHTTNATA
FT                   SRNVLENIYDTLVMLDSKGRIVPGLAQSWSVSADGLTWTFRLRPGVTFHNGDPLKASDV
FT                   VFSINRIKDPATKSPRANDFALVRSVTAPNNNTVVITLSQPFSPLLAKLAFSTNAIVSE
FT                   KVAKEHNNDLNKAVIGTGPFRFVEYIPQTRLVVRKWDKYWQKDNQGRPLPYLDGITYTF
FT                   YPDPAARSTALRAGAVDWIEYVTAADVRPLKADRNLVVVGGPSANFRALYFNTTREPYN
FT                   NPKVRQAIAYAIDKKAIVDLALFGTGGIVARGTTIPSGAYAYTNSPYNTRDVAKAKQLL
FT                   AEAGLPNGFTMNLYVTSTYDFLRTPADVIRDNLAEVGIRVNIQAEDWNVYLPKALRSEF
FT                   DVTLLGTSGQADPDDYLFNTFHPSSALNLSKYKNDRVTQLLEQGRRVSSQSERQRIYTQ
FT                   VQELVLQDSPMVFLFHSAQYEAMNRRVQGFLHFPNTSYLAFRYTWLQ"
     MKKLLVLLVL VLATVSLAQK AGGILRAGMQ TDPVGLDPHT TNATASRNVL ENIYDTLVML        60
     DSKGRIVPGL AQSWSVSADG LTWTFRLRPG VTFHNGDPLK ASDVVFSINR IKDPATKSPR       120
     ANDFALVRSV TAPNNNTVVI TLSQPFSPLL AKLAFSTNAI VSEKVAKEHN NDLNKAVIGT       180
     GPFRFVEYIP QTRLVVRKWD KYWQKDNQGR PLPYLDGITY TFYPDPAARS TALRAGAVDW       240
     IEYVTAADVR PLKADRNLVV VGGPSANFRA LYFNTTREPY NNPKVRQAIA YAIDKKAIVD       300
     LALFGTGGIV ARGTTIPSGA YAYTNSPYNT RDVAKAKQLL AEAGLPNGFT MNLYVTSTYD       360
     FLRTPADVIR DNLAEVGIRV NIQAEDWNVY LPKALRSEFD VTLLGTSGQA DPDDYLFNTF       420
     HPSSALNLSK YKNDRVTQLL EQGRRVSSQS ERQRIYTQVQ ELVLQDSPMV FLFHSAQYEA       480
     MNRRVQGFLH FPNTSYLAFR YTWLQ                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page