(data stored in ACNUC7421 zone)

EMBL: CP001743.PE161

CP001743.PE161       Location/Qualifiers
FT   CDS             complement(143053..144003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0163"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A0P1D1 ABC transporter,
FT                   membrane spanning protein (Dipeptide); InterPro IPR000515;
FT                   COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; KEGG: mes:Meso_1505
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26943"
FT                   /protein_id="ADD26943.1"
FT                   /translation="MVGYVVNRLLAAIPTLLGVAIITFLLMRAVPGDVVTQLVGLEANV
FT                   SPERMAELRRLFGLDLPLHVQFGQWLGAVLQGDLGSSLRTGREVAQDLALRFPVTLQLT
FT                   LMGLFTALLIAVPLGVLAAIRRGGFVDYFASLFAILGLSVPGFFLALLLILLFALALGW
FT                   LPPAGFVPLTENPLENLRHMLLPALSLGLILAGAVTRILRSSMLEVLSRDYIRTARAKG
FT                   LAERVVIFRHALRNALIPVVTVIGIQFGSLLGGAVIIEQVFSLPGVGRFALEGINLRDY
FT                   PVVQGTVLFVASAAVLVNLLVDLLYSLIDPRIRYE"
     MVGYVVNRLL AAIPTLLGVA IITFLLMRAV PGDVVTQLVG LEANVSPERM AELRRLFGLD        60
     LPLHVQFGQW LGAVLQGDLG SSLRTGREVA QDLALRFPVT LQLTLMGLFT ALLIAVPLGV       120
     LAAIRRGGFV DYFASLFAIL GLSVPGFFLA LLLILLFALA LGWLPPAGFV PLTENPLENL       180
     RHMLLPALSL GLILAGAVTR ILRSSMLEVL SRDYIRTARA KGLAERVVIF RHALRNALIP       240
     VVTVIGIQFG SLLGGAVIIE QVFSLPGVGR FALEGINLRD YPVVQGTVLF VASAAVLVNL       300
     LVDLLYSLID PRIRYE                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page