(data stored in ACNUC7421 zone)

EMBL: CP001743.PE162

CP001743.PE162       Location/Qualifiers
FT   CDS             144141..144557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0164"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; SPTR: A2WGW6
FT                   Putative uncharacterized protein; InterPro
FT                   IPR006683:IPR003736; COGs: COG2050 Uncharacterized protein
FT                   possibly involved in aromatic compounds catabolism; KEGG:
FT                   aav:Aave_2878 uncharacterized domain 1; PFAM: Thioesterase
FT                   superfamily; TIGRFAM: uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26944"
FT                   /protein_id="ADD26944.1"
FT                   /translation="MEPTLEAAQAVLRSQPFSLLLNAQITSFGPDAVELRIPITDQLQQ
FT                   QHGFVHGGVISYAADNALTFVGGAALGPAVVTSEYKINYIRPAKGQALVARANLVHAGK
FT                   SQAVCQCQVFVVADDREILCALAQGTIVSMNQPK"
     MEPTLEAAQA VLRSQPFSLL LNAQITSFGP DAVELRIPIT DQLQQQHGFV HGGVISYAAD        60
     NALTFVGGAA LGPAVVTSEY KINYIRPAKG QALVARANLV HAGKSQAVCQ CQVFVVADDR       120
     EILCALAQGT IVSMNQPK                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page