(data stored in ACNUC7421 zone)

EMBL: CP001743.PE164

CP001743.PE164       Location/Qualifiers
FT   CDS             complement(145614..146426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0166"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A4AKA0
FT                   Binding-protein-dependent transport permease; InterPro
FT                   IPR000515; COGs: COG0395 ABC-type sugar transport system
FT                   permease component; KEGG: bha:BH3847 ABC transporter
FT                   (permease); PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26946"
FT                   /protein_id="ADD26946.1"
FT                   /translation="MIGRILQYTILFIATLFFLLPVYLVIVTAFKEPSAITLSSTWQLP
FT                   QVWYWESFAQAWTAFAPKLQNSFFLTITATILSALLGSLNGYVLAKWKFPGANIVFPLM
FT                   LFGMFIPYQAVLIPLFQFVREIGLGGSLWGLILVHVVYGLPITTLIFRNYYAEIPDEMI
FT                   EAGRIDGAGFFGIYSRIVFPLSVPGFVVVIIWQFTQIWNEFLFAVTLVSSPANQPITVA
FT                   LAQLAGGEAVKWNLPMAGALLAALPTLLVYIFLGRYFIRGLLAGSVKG"
     MIGRILQYTI LFIATLFFLL PVYLVIVTAF KEPSAITLSS TWQLPQVWYW ESFAQAWTAF        60
     APKLQNSFFL TITATILSAL LGSLNGYVLA KWKFPGANIV FPLMLFGMFI PYQAVLIPLF       120
     QFVREIGLGG SLWGLILVHV VYGLPITTLI FRNYYAEIPD EMIEAGRIDG AGFFGIYSRI       180
     VFPLSVPGFV VVIIWQFTQI WNEFLFAVTL VSSPANQPIT VALAQLAGGE AVKWNLPMAG       240
     ALLAALPTLL VYIFLGRYFI RGLLAGSVKG                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page