(data stored in ACNUC7421 zone)

EMBL: CP001743.PE166

CP001743.PE166       Location/Qualifiers
FT   CDS             complement(147700..148938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0168"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: A4AJ89 Bacterial extracellular solute-binding
FT                   protein; InterPro IPR006059; COGs: COG1653 ABC-type sugar
FT                   transport system periplasmic component; KEGG: dde:Dde_3657
FT                   sugar ABC transporter, substrate-binding protein; PFAM:
FT                   Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26948"
FT                   /protein_id="ADD26948.1"
FT                   /translation="MKKLFLTLAALALGTAGLAQSGKLEIFSWWAGDEGPALQALIDLY
FT                   KKRYPNVEVINATVTGGSGVNARAVLKTRMLGGDPPDSFQVHAGQELIGTWVVADRMED
FT                   LTPLFNQEGWMTKFPKGLIDLLSYKGKIYSVPVNIHRSNVMWYVPAKLREWGVQPPKTW
FT                   AEFLTVCQTLKSKGLEAPLALGENWTQQHLWESVALGVLGATDYANLWTGKLRFNDPKA
FT                   VAVWNTFGRVLDCANKDASGLSWQQAIDRVLEGRAAFNIMGDWAAGYMTTTKGLKPGEG
FT                   FGWAPAPGTAGVFMMLSDSFGLPKGVKNRTNVLNWLRLLGSKEGQDTFNPLKGSIAART
FT                   DSDPSKYNAYLQSAMRDWKSNRIVGSLVHGAVAPESFMSQFGTVMEIYLSSRNAQAAAN
FT                   AAQAIATQVRLGQ"
     MKKLFLTLAA LALGTAGLAQ SGKLEIFSWW AGDEGPALQA LIDLYKKRYP NVEVINATVT        60
     GGSGVNARAV LKTRMLGGDP PDSFQVHAGQ ELIGTWVVAD RMEDLTPLFN QEGWMTKFPK       120
     GLIDLLSYKG KIYSVPVNIH RSNVMWYVPA KLREWGVQPP KTWAEFLTVC QTLKSKGLEA       180
     PLALGENWTQ QHLWESVALG VLGATDYANL WTGKLRFNDP KAVAVWNTFG RVLDCANKDA       240
     SGLSWQQAID RVLEGRAAFN IMGDWAAGYM TTTKGLKPGE GFGWAPAPGT AGVFMMLSDS       300
     FGLPKGVKNR TNVLNWLRLL GSKEGQDTFN PLKGSIAART DSDPSKYNAY LQSAMRDWKS       360
     NRIVGSLVHG AVAPESFMSQ FGTVMEIYLS SRNAQAAANA AQAIATQVRL GQ               412
//

If you have problems or comments...

PBIL Back to PBIL home page