(data stored in ACNUC7421 zone)

EMBL: CP001743.PE17

CP001743.PE17        Location/Qualifiers
FT   CDS             15590..17449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0017"
FT                   /product="deoxyxylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="SPTR: Q72H81 1-deoxy-D-xylulose-5-phosphate
FT                   synthase; KEGG: mpt:Mpe_A2631
FT                   1-deoxy-D-xylulose-5-phosphate synthase; COGs: COG1154
FT                   Deoxyxylulose-5-phosphate synthase; InterPro
FT                   IPR005476:IPR005475:IPR005477; TIGRFAM:
FT                   deoxyxylulose-5-phosphate synthase; PFAM: Transketolase
FT                   central region; Transketolase domain protein; PFAM:
FT                   Transketolase, C-terminal domain; Transketolase, pyrimidine
FT                   binding domain; TIGRFAM: 1-deoxy-D-xylulose-5-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26799"
FT                   /protein_id="ADD26799.1"
FT                   /translation="MILQKVNQPQDLKTLTQEELLQLAQELRSEIIRVCAQNGGHLASS
FT                   LGAVELIVALHRVFDSPRDRLLFDVGHQAYAHKILTGRKEVFHTIRQEGGISGFTKVSE
FT                   SEHDAITVGHASTSLANALGMAIARDTLGENYHVVGIIGDGALTGGMALAALNVIGERK
FT                   PRLLMILNDNEMSISENVGALNRYFKEYQTKKWVQDTQKWGKQVLEGISPRLFSLVDRA
FT                   KEAAKLMLHQENPFYAWGIRYVGPVDGHDLPGLIHILEQIKELDGPTLLHIVTQKGKGY
FT                   GVAEEDPIYWHGPPGFNPQKPEKVSKGYSWSAAFGDAVTELAHKEPRLFVITPAMREGS
FT                   GLVKYSQTHPERYLDTGICEDVAATVAAGMALRGLKPVLAIYSTFMQRAYDQIIHDIAI
FT                   ENLSVVFAVDRAGIVGGDGATHNGVFDIAYLRTVPNVQIAAPKDALELRAMLKKALELG
FT                   GPIAIRYARDNVEKAPEGVWPEIEWGRWEVLKEGSKAYILAFGKTLKYALEAAQDHPEI
FT                   GVINARFLKPLDKGMLEALALEGYKLVTTEDHQKMGGFGSAVLEALNELGLKPDIRVLG
FT                   LPDVFFDHGSIPRMHREAGIDAAAIRAALAGMGLEVKTATRRV"
     MILQKVNQPQ DLKTLTQEEL LQLAQELRSE IIRVCAQNGG HLASSLGAVE LIVALHRVFD        60
     SPRDRLLFDV GHQAYAHKIL TGRKEVFHTI RQEGGISGFT KVSESEHDAI TVGHASTSLA       120
     NALGMAIARD TLGENYHVVG IIGDGALTGG MALAALNVIG ERKPRLLMIL NDNEMSISEN       180
     VGALNRYFKE YQTKKWVQDT QKWGKQVLEG ISPRLFSLVD RAKEAAKLML HQENPFYAWG       240
     IRYVGPVDGH DLPGLIHILE QIKELDGPTL LHIVTQKGKG YGVAEEDPIY WHGPPGFNPQ       300
     KPEKVSKGYS WSAAFGDAVT ELAHKEPRLF VITPAMREGS GLVKYSQTHP ERYLDTGICE       360
     DVAATVAAGM ALRGLKPVLA IYSTFMQRAY DQIIHDIAIE NLSVVFAVDR AGIVGGDGAT       420
     HNGVFDIAYL RTVPNVQIAA PKDALELRAM LKKALELGGP IAIRYARDNV EKAPEGVWPE       480
     IEWGRWEVLK EGSKAYILAF GKTLKYALEA AQDHPEIGVI NARFLKPLDK GMLEALALEG       540
     YKLVTTEDHQ KMGGFGSAVL EALNELGLKP DIRVLGLPDV FFDHGSIPRM HREAGIDAAA       600
     IRAALAGMGL EVKTATRRV                                                    619
//

If you have problems or comments...

PBIL Back to PBIL home page