(data stored in ACNUC7421 zone)

EMBL: CP001743.PE171

CP001743.PE171       Location/Qualifiers
FT   CDS             152782..154347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0173"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="TIGRFAM: D-3-phosphoglycerate dehydrogenase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region; amino acid-binding ACT domain protein; InterPro
FT                   IPR006139:IPR002912:IPR006140:IPR006236; KEGG:
FT                   glo:Glov_2087 D-3-phosphoglycerate dehydrogenase; COGs:
FT                   COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenase; SPTR: O29445 D-3-phosphoglycerate
FT                   dehydrogenase; PFAM: ACT domain; D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD binding domain; TIGRFAM:
FT                   D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26953"
FT                   /protein_id="ADD26953.1"
FT                   /translation="MWKVLVTDEMRLGEVKHPQVRLDYKPGMAREELLQVIGAYDALIT
FT                   RSRTQVDARVLEAGVNLKVVGRGGVGVDNVDLEAASRRGILVVNVPEANTRSAAELAWA
FT                   LLLATARGLVESDQKIRQGQWDRKYLGLELNHKTLGIVGLGRIGGQVAKFAKGFDMRVL
FT                   AYDPYIPRSRAQTLGVELFDDLADMLRQCHFLTVHTPLTEETRGLIGRRELYLLPKGAV
FT                   VVNAARGGIVDEKALVEVLNDGHLWGAGLDVFVEEPPNAEHPLVHHPKVVHTAHLGANT
FT                   IEAQERVGEAVLERVIETLQGNLAHALNTGFDAEGLQLFSAWLPLGEALGKLLAQITQG
FT                   RPQAVEVSYYGDFEKNPDPIASAVAKGLLEQVLEAGAINLVSARPLLRDRGIALVTRQV
FT                   QEPLDYRQVLEVRLETDKETRKVRGAVLGGKPRIVGIDDHTVEAVPRGFMLVCINRDRP
FT                   GVVGKVGTLLGENNINIAGMQLGRDNPGGKALFVLAIDERPGEAVLSALRGLDVLERVD
FT                   LAEL"
     MWKVLVTDEM RLGEVKHPQV RLDYKPGMAR EELLQVIGAY DALITRSRTQ VDARVLEAGV        60
     NLKVVGRGGV GVDNVDLEAA SRRGILVVNV PEANTRSAAE LAWALLLATA RGLVESDQKI       120
     RQGQWDRKYL GLELNHKTLG IVGLGRIGGQ VAKFAKGFDM RVLAYDPYIP RSRAQTLGVE       180
     LFDDLADMLR QCHFLTVHTP LTEETRGLIG RRELYLLPKG AVVVNAARGG IVDEKALVEV       240
     LNDGHLWGAG LDVFVEEPPN AEHPLVHHPK VVHTAHLGAN TIEAQERVGE AVLERVIETL       300
     QGNLAHALNT GFDAEGLQLF SAWLPLGEAL GKLLAQITQG RPQAVEVSYY GDFEKNPDPI       360
     ASAVAKGLLE QVLEAGAINL VSARPLLRDR GIALVTRQVQ EPLDYRQVLE VRLETDKETR       420
     KVRGAVLGGK PRIVGIDDHT VEAVPRGFML VCINRDRPGV VGKVGTLLGE NNINIAGMQL       480
     GRDNPGGKAL FVLAIDERPG EAVLSALRGL DVLERVDLAE L                           521
//

If you have problems or comments...

PBIL Back to PBIL home page