(data stored in ACNUC7421 zone)

EMBL: CP001743.PE173

CP001743.PE173       Location/Qualifiers
FT   CDS             155485..156288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0175"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; SPTR: A3VBL8 Oxidoreductase, short-chain
FT                   dehydrogenase/reductase family protein; InterPro
FT                   IPR002347:IPR002424:IPR002198:IPR013968; COGs: COG0300
FT                   Short-chain dehydrogenase of various substrate
FT                   specificities; KEGG: pla:Plav_0391 short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26955"
FT                   /protein_id="ADD26955.1"
FT                   /translation="MKVQGKVVVVTGGGSGMGRALVLRLLSKGARVAAVDLNAASLQET
FT                   AQLAQAAERLSTHVLNITQREAVEALPAEVMARHGAVDGLINNAGIIQPFVRVNDLDYG
FT                   AIERVMNVNFYGTLYMTKAFLPHLLQRPEAHIVNISSMGGFLPVPGQSVYGASKAAVKL
FT                   LSEGLFAELLDTPVRVTVVFPGAVSTNITVNSGVAIRAAEGRQPAARPLEPERAAQIIV
FT                   EGMEQNRFRVLVGSDARLMDFLYRLSPERAARFIYRQMRSLLGAS"
     MKVQGKVVVV TGGGSGMGRA LVLRLLSKGA RVAAVDLNAA SLQETAQLAQ AAERLSTHVL        60
     NITQREAVEA LPAEVMARHG AVDGLINNAG IIQPFVRVND LDYGAIERVM NVNFYGTLYM       120
     TKAFLPHLLQ RPEAHIVNIS SMGGFLPVPG QSVYGASKAA VKLLSEGLFA ELLDTPVRVT       180
     VVFPGAVSTN ITVNSGVAIR AAEGRQPAAR PLEPERAAQI IVEGMEQNRF RVLVGSDARL       240
     MDFLYRLSPE RAARFIYRQM RSLLGAS                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page