(data stored in ACNUC7421 zone)

EMBL: CP001743.PE176

CP001743.PE176       Location/Qualifiers
FT   CDS             158238..159218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0178"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="TIGRFAM: quinone oxidoreductase, YhdH/YhfP family;
FT                   PFAM: Alcohol dehydrogenase GroES domain protein; Alcohol
FT                   dehydrogenase zinc-binding domain protein; InterPro
FT                   IPR013154:IPR013149:IPR014188; KEGG: azo:azo3317
FT                   zinc-binding alcohol dehydrogenase; COGs: COG0604
FT                   NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductase; SPTR: A4U4H3 Alcohol dehydrogenase,
FT                   zinc-containing; PFAM: Zinc-binding dehydrogenase; Alcohol
FT                   dehydrogenase GroES-like domain; TIGRFAM: putative quinone
FT                   oxidoreductase, YhdH/YhfP family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26958"
FT                   /protein_id="ADD26958.1"
FT                   /translation="MQTFKALVVESGDPYTAQIRQARLDELPPGEVLVRVAYSSLNYKD
FT                   GLAITGAGKVIRNFPMVPGIDLAGTVLESASPEYKPGDPVILTGWGVGERHWGGLSELA
FT                   RVRGEWLVPLPEGLTLKQAMGIGTAGFTAMLAVMALEAHSIDPAREVLVTGAAGGVGSL
FT                   AVALLAQRGYRVVASTGRLSEETYLKSLGASEILDRAVLSAPGKPLESERFGGAVDTVG
FT                   GAVLAGVLPRMAYGGSVAACGNAGGAKLETTVFPFILRGVNLLGIDSVMCPKEKRLLAW
FT                   QRLARELPKPLLEATLQTVSLEEVPVLAQAILQGRVRGRVVVKLD"
     MQTFKALVVE SGDPYTAQIR QARLDELPPG EVLVRVAYSS LNYKDGLAIT GAGKVIRNFP        60
     MVPGIDLAGT VLESASPEYK PGDPVILTGW GVGERHWGGL SELARVRGEW LVPLPEGLTL       120
     KQAMGIGTAG FTAMLAVMAL EAHSIDPARE VLVTGAAGGV GSLAVALLAQ RGYRVVASTG       180
     RLSEETYLKS LGASEILDRA VLSAPGKPLE SERFGGAVDT VGGAVLAGVL PRMAYGGSVA       240
     ACGNAGGAKL ETTVFPFILR GVNLLGIDSV MCPKEKRLLA WQRLARELPK PLLEATLQTV       300
     SLEEVPVLAQ AILQGRVRGR VVVKLD                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page