(data stored in ACNUC7421 zone)

EMBL: CP001743.PE177

CP001743.PE177       Location/Qualifiers
FT   CDS             159281..159922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0179"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase; InterPro IPR002123:IPR004552; KEGG:
FT                   bha:BH1635 hypothetical protein; COGs: COG0204
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase; SPTR:
FT                   A1HTW7 1-acyl-sn-glycerol-3-phosphate acyltransferases;
FT                   PFAM: Acyltransferase; TIGRFAM:
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26959"
FT                   /protein_id="ADD26959.1"
FT                   /translation="MYEYGLGVYKVCKVIARFLLQVLFGLKVEGAEKIPKEGPVILASN
FT                   HMSFLDPVVMGVACPRVVSYMSRDDVFNYPILRWLLPRLYVIPVSRGSGDLGAIKAAIR
FT                   VLKNGMAFGIFPEGRRSRTGFIEPFKTGAAAIALRTGAVIVPAAIIGSDKAWPVGKGPR
FT                   LRRGVRVVFGDPLVLPPGKPDHQTLEEVTHRLEAAVTALLPPEYHRKPTV"
     MYEYGLGVYK VCKVIARFLL QVLFGLKVEG AEKIPKEGPV ILASNHMSFL DPVVMGVACP        60
     RVVSYMSRDD VFNYPILRWL LPRLYVIPVS RGSGDLGAIK AAIRVLKNGM AFGIFPEGRR       120
     SRTGFIEPFK TGAAAIALRT GAVIVPAAII GSDKAWPVGK GPRLRRGVRV VFGDPLVLPP       180
     GKPDHQTLEE VTHRLEAAVT ALLPPEYHRK PTV                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page