(data stored in ACNUC7421 zone)

EMBL: CP001743.PE178

CP001743.PE178       Location/Qualifiers
FT   CDS             160030..160332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0180"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; InterPro
FT                   IPR000119; KEGG: bcb:BCB4264_A1566 DNA-binding protein HU;
FT                   COGs: COG0776 Bacterial nucleoid DNA-binding protein; SPTR:
FT                   P19436 DNA-binding protein HU; PFAM: Bacterial DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26960"
FT                   /protein_id="ADD26960.1"
FT                   /translation="MARAAAKKTKTKADLIDQVAATAGLKKKDAKAAVDAFLSKVEEAL
FT                   KAGNKVQLTGFGTFEVRSRKARTGVKPGTTQKIKIPASKYPAFKPGKALKETVKK"
     MARAAAKKTK TKADLIDQVA ATAGLKKKDA KAAVDAFLSK VEEALKAGNK VQLTGFGTFE        60
     VRSRKARTGV KPGTTQKIKI PASKYPAFKP GKALKETVKK                             100
//

If you have problems or comments...

PBIL Back to PBIL home page