(data stored in ACNUC7421 zone)

EMBL: CP001743.PE18

CP001743.PE18        Location/Qualifiers
FT   CDS             17645..17830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26800"
FT                   /protein_id="ADD26800.1"
FT                   /translation="MKKIFFKLLALLVGRLLARRFGYGRPYYPAHYDPHYRGGFFKPYK
FT                   YKRKKSWRKKLLDWLD"
     MKKIFFKLLA LLVGRLLARR FGYGRPYYPA HYDPHYRGGF FKPYKYKRKK SWRKKLLDWL        60
     D                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page