(data stored in ACNUC7421 zone)

EMBL: CP001743.PE181

CP001743.PE181       Location/Qualifiers
FT   CDS             complement(161899..162672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0183"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; RNA-binding S4 domain
FT                   protein; SMART: RNA-binding S4 domain protein; InterPro
FT                   IPR002942:IPR006145:IPR000748; KEGG: bcy:Bcer98_3369
FT                   pseudouridine synthase; COGs: COG1187 16S rRNA uridine-516
FT                   pseudouridylate synthase and related pseudouridylate
FT                   synthase; SPTR: A1HLV7 Pseudouridine synthase; PFAM: S4
FT                   domain; RNA pseudouridylate synthase; TIGRFAM:
FT                   pseudouridine synthase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26963"
FT                   /protein_id="ADD26963.1"
FT                   /translation="MLILSAPVIGGFLFNMAYERLDKVLGHLGVGSRKEIHRLARAGLI
FT                   TINGKIVADAGFKFDPSQAHIEVAGEPLVYQKFFYLLLNKPAGYITSTKDPSGTPITAL
FT                   LPEEFWRNDWMPVGRLDKDTEGLLLLTTDGELLHRLTHPRWKVTKRYYVELASPATPED
FT                   VAVFAAGTLELEGEPLQPAELYLGPDPRKVELVLREGRFHQVKRMFAARGNQVTYLKRL
FT                   AFGPLQLPPNLPPGASRQLTPDEIKALYEVVGLPG"
     MLILSAPVIG GFLFNMAYER LDKVLGHLGV GSRKEIHRLA RAGLITINGK IVADAGFKFD        60
     PSQAHIEVAG EPLVYQKFFY LLLNKPAGYI TSTKDPSGTP ITALLPEEFW RNDWMPVGRL       120
     DKDTEGLLLL TTDGELLHRL THPRWKVTKR YYVELASPAT PEDVAVFAAG TLELEGEPLQ       180
     PAELYLGPDP RKVELVLREG RFHQVKRMFA ARGNQVTYLK RLAFGPLQLP PNLPPGASRQ       240
     LTPDEIKALY EVVGLPG                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page