(data stored in ACNUC7421 zone)

EMBL: CP001743.PE187

CP001743.PE187       Location/Qualifiers
FT   CDS             165202..165546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26969"
FT                   /protein_id="ADD26969.1"
FT                   /translation="MERAGTVLEMGGYWSLLPSADKNWEPNVIITAEIEGKIRRKHNVR
FT                   PQEVHQALADPKRRSRPVMSEGENPVALVVGSTDAGRKLTMIVILLPDSLYLVSARTAR
FT                   AREIAEVHYE"
     MERAGTVLEM GGYWSLLPSA DKNWEPNVII TAEIEGKIRR KHNVRPQEVH QALADPKRRS        60
     RPVMSEGENP VALVVGSTDA GRKLTMIVIL LPDSLYLVSA RTARAREIAE VHYE             114
//

If you have problems or comments...

PBIL Back to PBIL home page