(data stored in ACNUC7421 zone)

EMBL: CP001743.PE191

CP001743.PE191       Location/Qualifiers
FT   CDS             166918..168264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0193"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; InterPro
FT                   IPR011701; KEGG: mxa:MXAN_4533 major facilitator family
FT                   transporter; SPTR: A0Z9Q5 Putative uncharacterized protein;
FT                   PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26973"
FT                   /protein_id="ADD26973.1"
FT                   /translation="MQPYLTGLRGFTLVALGQLVSLVGSGMSQFALTIWAFEKTGLATS
FT                   LALMGFFYMVPLILISPLAGAWVDRGNRKLMMMLSDLGAAGGTLVVFLLYLSGNLEIWH
FT                   LYVVGTLNGLTSAFQWPAYSAAISTMVHKRDYARANGLLSLAESASGIGAPILAGILLG
FT                   LVGLRGILLLDLLTFTAAFTTLMLVHVPQPKPSAAGRESRGSLLGEALYGFRFIFARPS
FT                   LLGLQTVFLLGNLVANLGSAIMAAMILARTASSETALATVQSAAGVGGVLGGVLLSTWG
FT                   GPRRKVHGVLMGWVLSSFFGSVLLGLGQSVWVWATCAFIFALIVPILNGSNQAIWQAKV
FT                   PPDVQGKVFAARRMIAWVAGPLAMLVAGPLADRVLTPAMMPDGALAGVFGGLVGVGPGA
FT                   GMAFLLVISGLLGMVVGLGGYLFRVVREAEDLIPDHDHTPEVRPEPVAS"
     MQPYLTGLRG FTLVALGQLV SLVGSGMSQF ALTIWAFEKT GLATSLALMG FFYMVPLILI        60
     SPLAGAWVDR GNRKLMMMLS DLGAAGGTLV VFLLYLSGNL EIWHLYVVGT LNGLTSAFQW       120
     PAYSAAISTM VHKRDYARAN GLLSLAESAS GIGAPILAGI LLGLVGLRGI LLLDLLTFTA       180
     AFTTLMLVHV PQPKPSAAGR ESRGSLLGEA LYGFRFIFAR PSLLGLQTVF LLGNLVANLG       240
     SAIMAAMILA RTASSETALA TVQSAAGVGG VLGGVLLSTW GGPRRKVHGV LMGWVLSSFF       300
     GSVLLGLGQS VWVWATCAFI FALIVPILNG SNQAIWQAKV PPDVQGKVFA ARRMIAWVAG       360
     PLAMLVAGPL ADRVLTPAMM PDGALAGVFG GLVGVGPGAG MAFLLVISGL LGMVVGLGGY       420
     LFRVVREAED LIPDHDHTPE VRPEPVAS                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page