(data stored in ACNUC7421 zone)

EMBL: CP001743.PE192

CP001743.PE192       Location/Qualifiers
FT   CDS             168324..168962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0194"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; PRIAM: ATP
FT                   phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region; InterPro
FT                   IPR013820; KEGG: pca:Pcar_2689 ATP
FT                   phosphoribosyltransferase catalytic subunit; COGs: COG0040
FT                   ATP phosphoribosyltransferase; SPTR: Q5SM15 ATP
FT                   phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase; TIGRFAM: ATP
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26974"
FT                   /protein_id="ADD26974.1"
FT                   /translation="MIRGRFTLVVALPKGRNFADGYRALAQAGLELPPLEGERALLHGQ
FT                   EGGVAVLELRNHDVPTYVDLGIADVGVVGNDVLLESGRDVYEPVDLGTGACRLSLIRHP
FT                   AATDPIRRIATKYPRFTAQVLRERGMVADIIELAGNVELAALTGLADAVVDVVQTGATL
FT                   KAAGLLEVEVLAHSTARFIVNRQSLKLKRDLLRPLIERLRANAHNLPAS"
     MIRGRFTLVV ALPKGRNFAD GYRALAQAGL ELPPLEGERA LLHGQEGGVA VLELRNHDVP        60
     TYVDLGIADV GVVGNDVLLE SGRDVYEPVD LGTGACRLSL IRHPAATDPI RRIATKYPRF       120
     TAQVLRERGM VADIIELAGN VELAALTGLA DAVVDVVQTG ATLKAAGLLE VEVLAHSTAR       180
     FIVNRQSLKL KRDLLRPLIE RLRANAHNLP AS                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page