(data stored in ACNUC7421 zone)

EMBL: CP001743.PE2

CP001743.PE2         Location/Qualifiers
FT   CDS             1862..2947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); KEGG: rpt:Rpal_0002 DNA polymerase III,
FT                   beta subunit; SPTR: A3WSP5 DNA polymerase III subunit beta;
FT                   SMART: DNA polymerase III beta chain; PFAM: DNA polymerase
FT                   III beta chain; PRIAM: DNA-directed DNA polymerase;
FT                   TIGRFAM: DNA polymerase III, beta subunit; InterPro
FT                   IPR001001; PFAM: DNA polymerase III beta subunit,
FT                   C-terminal domain; DNA polymerase III beta subunit,
FT                   N-terminal domain; DNA polymerase III beta subunit, central
FT                   domain; TIGRFAM: DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26784"
FT                   /protein_id="ADD26784.1"
FT                   /translation="MEVRIPKRTLAEGLSILERIIPSRSSNPILTYLPMELSDQGLILR
FT                   GTNGEVDIEVKLPAEVQGTGQVLVPAQTFVQIVRSAPGELVELIFGGKERLELHSGAFN
FT                   TQLATTGPDGYPELSFGPPGPEKIAASRLAQAITRVRYAASTEEFRAIFRGVQIEMSPT
FT                   SLRAVASDGYRLACYDLPMQLQTRKLVIPARSADEIVRVFKDAQGEVALAVAEGTLTLV
FT                   GEAVRMSVKLMEGEFPDYGRVIPQSFVLEATLQAEALRESLKRVAVLSDRNNHRVNLLF
FT                   NHNKLDIDAEGDYGRGREELGIEASGEPQLMVAYNAQFLIDALAPIEGAVRIKLSGPTS
FT                   PSLVQAVEDSGYLAVVVPLRV"
     MEVRIPKRTL AEGLSILERI IPSRSSNPIL TYLPMELSDQ GLILRGTNGE VDIEVKLPAE        60
     VQGTGQVLVP AQTFVQIVRS APGELVELIF GGKERLELHS GAFNTQLATT GPDGYPELSF       120
     GPPGPEKIAA SRLAQAITRV RYAASTEEFR AIFRGVQIEM SPTSLRAVAS DGYRLACYDL       180
     PMQLQTRKLV IPARSADEIV RVFKDAQGEV ALAVAEGTLT LVGEAVRMSV KLMEGEFPDY       240
     GRVIPQSFVL EATLQAEALR ESLKRVAVLS DRNNHRVNLL FNHNKLDIDA EGDYGRGREE       300
     LGIEASGEPQ LMVAYNAQFL IDALAPIEGA VRIKLSGPTS PSLVQAVEDS GYLAVVVPLR       360
     V                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page